


| Basic Information | |
|---|---|
| Family ID | F026592 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 42 residues |
| Representative Sequence | CLRTASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.95 % |
| % of genes from short scaffolds (< 2000 bps) | 61.93 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.371 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human (34.010 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut (54.315 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 0.00% Coil/Unstructured: 86.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF14198 | TnpV | 19.29 |
| PF14287 | DUF4368 | 9.64 |
| PF05857 | TraX | 9.14 |
| PF00005 | ABC_tran | 4.57 |
| PF07242 | DUF1430 | 3.05 |
| PF01381 | HTH_3 | 2.54 |
| PF00078 | RVT_1 | 2.03 |
| PF01641 | SelR | 2.03 |
| PF07786 | HGSNAT_cat | 2.03 |
| PF08006 | DUF1700 | 1.52 |
| PF00293 | NUDIX | 1.52 |
| PF15594 | Imm50 | 1.52 |
| PF00589 | Phage_integrase | 1.02 |
| PF13238 | AAA_18 | 1.02 |
| PF06250 | YhcG_C | 1.02 |
| PF11667 | DUF3267 | 0.51 |
| PF00795 | CN_hydrolase | 0.51 |
| PF13783 | DUF4177 | 0.51 |
| PF03551 | PadR | 0.51 |
| PF00583 | Acetyltransf_1 | 0.51 |
| PF00365 | PFK | 0.51 |
| PF03432 | Relaxase | 0.51 |
| PF11457 | DUF3021 | 0.51 |
| PF09234 | DUF1963 | 0.51 |
| PF06854 | Phage_Gp15 | 0.51 |
| PF13346 | ABC2_membrane_5 | 0.51 |
| PF12837 | Fer4_6 | 0.51 |
| PF14319 | Zn_Tnp_IS91 | 0.51 |
| PF03389 | MobA_MobL | 0.51 |
| PF00557 | Peptidase_M24 | 0.51 |
| PF09491 | RE_AlwI | 0.51 |
| PF08388 | GIIM | 0.51 |
| PF10694 | DUF2500 | 0.51 |
| PF12728 | HTH_17 | 0.51 |
| PF14080 | DUF4261 | 0.51 |
| PF00664 | ABC_membrane | 0.51 |
| PF12958 | DUF3847 | 0.51 |
| PF03575 | Peptidase_S51 | 0.51 |
| PF01066 | CDP-OH_P_transf | 0.51 |
| PF17225 | DUF5301 | 0.51 |
| PF02690 | Na_Pi_cotrans | 0.51 |
| PF13599 | Pentapeptide_4 | 0.51 |
| PF12650 | DUF3784 | 0.51 |
| PF12644 | DUF3782 | 0.51 |
| PF07883 | Cupin_2 | 0.51 |
| PF12395 | DUF3658 | 0.51 |
| PF12687 | DUF3801 | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG4652 | Uncharacterized conserved protein, DUF1430 domain | Function unknown [S] | 3.05 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 2.03 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 2.03 |
| COG4709 | Uncharacterized membrane protein | Function unknown [S] | 1.52 |
| COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 1.02 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.51 |
| COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.51 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.51 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.51 |
| COG1283 | Na+/phosphate symporter | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.51 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.51 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.51 |
| COG3843 | Type IV secretory pathway, VirD2 component (relaxase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.51 |
| COG3878 | Uncharacterized conserved protein YwqG, DUF1963 family | Function unknown [S] | 0.51 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.37 % |
| Unclassified | root | N/A | 8.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559011|E4LJNJL01A8Y8Q | Not Available | 544 | Open in IMG/M |
| 3300000292|EM305_1003047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 888 | Open in IMG/M |
| 3300000293|EM308_1001910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1290 | Open in IMG/M |
| 3300001528|chfe1id_10033279 | Not Available | 1954 | Open in IMG/M |
| 3300002163|JGI24707J26582_10211445 | Not Available | 500 | Open in IMG/M |
| 3300006258|Ga0099398_104432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2478 | Open in IMG/M |
| 3300006258|Ga0099398_106640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1361 | Open in IMG/M |
| 3300006258|Ga0099398_110020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 770 | Open in IMG/M |
| 3300006312|Ga0099626_104137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3217 | Open in IMG/M |
| 3300006463|Ga0100176_1008564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3743 | Open in IMG/M |
| 3300006463|Ga0100176_1023639 | Not Available | 1332 | Open in IMG/M |
| 3300006502|Ga0100528_127903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 673 | Open in IMG/M |
| 3300006568|Ga0100215_100669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 40124 | Open in IMG/M |
| 3300007043|Ga0102536_107066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1559 | Open in IMG/M |
| 3300007097|Ga0102537_105751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2184 | Open in IMG/M |
| 3300007097|Ga0102537_109219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1120 | Open in IMG/M |
| 3300007108|Ga0102731_108826 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300007109|Ga0102633_106407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3525 | Open in IMG/M |
| 3300007109|Ga0102633_113118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1736 | Open in IMG/M |
| 3300007109|Ga0102633_139584 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300007184|Ga0103258_106770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3919 | Open in IMG/M |
| 3300007184|Ga0103258_111603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2038 | Open in IMG/M |
| 3300007184|Ga0103258_119383 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300007210|Ga0103359_119148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1192 | Open in IMG/M |
| 3300007210|Ga0103359_122419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1017 | Open in IMG/M |
| 3300007292|Ga0104320_103541 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300007292|Ga0104320_103705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1486 | Open in IMG/M |
| 3300007296|Ga0104830_105899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3300 | Open in IMG/M |
| 3300007298|Ga0104838_107031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3236 | Open in IMG/M |
| 3300007362|Ga0104788_107204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2802 | Open in IMG/M |
| 3300007362|Ga0104788_115546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1098 | Open in IMG/M |
| 3300007524|Ga0105481_1021422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1282 | Open in IMG/M |
| 3300007650|Ga0105532_104007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 4501 | Open in IMG/M |
| 3300007669|Ga0105546_108640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2906 | Open in IMG/M |
| 3300007714|Ga0105661_1020590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Erysipelatoclostridium → [Clostridium] innocuum | 1422 | Open in IMG/M |
| 3300007714|Ga0105661_1047635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 647 | Open in IMG/M |
| 3300007717|Ga0105662_119719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1639 | Open in IMG/M |
| 3300007742|Ga0105758_1043360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 642 | Open in IMG/M |
| 3300007801|Ga0105807_105050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. 4_3_54A2FAA | 2931 | Open in IMG/M |
| 3300007802|Ga0105667_125644 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300007804|Ga0105665_103304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 3785 | Open in IMG/M |
| 3300007805|Ga0105637_103990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3432 | Open in IMG/M |
| 3300008060|Ga0114177_107525 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300008077|Ga0105964_1007430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Lacrimispora → Lacrimispora saccharolytica | 3620 | Open in IMG/M |
| 3300008096|Ga0114155_1016415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 2169 | Open in IMG/M |
| 3300008096|Ga0114155_1018124 | Not Available | 1944 | Open in IMG/M |
| 3300008101|Ga0114024_117965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1073 | Open in IMG/M |
| 3300008103|Ga0114180_107272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Lacrimispora → Lacrimispora saccharolytica | 3255 | Open in IMG/M |
| 3300008129|Ga0114848_103207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Lacrimispora → Lacrimispora saccharolytica | 3222 | Open in IMG/M |
| 3300008129|Ga0114848_110524 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300008272|Ga0111092_1017750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1723 | Open in IMG/M |
| 3300008272|Ga0111092_1025714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1179 | Open in IMG/M |
| 3300008301|Ga0114871_101347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3844 | Open in IMG/M |
| 3300008306|Ga0115184_1006456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2204 | Open in IMG/M |
| 3300008326|Ga0115311_128944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 699 | Open in IMG/M |
| 3300008361|Ga0115082_104632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium 8_1_57FAA | 3867 | Open in IMG/M |
| 3300008361|Ga0115082_117617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter valericigenes | 756 | Open in IMG/M |
| 3300008404|Ga0115185_104394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Lacrimispora → Lacrimispora saccharolytica | 4270 | Open in IMG/M |
| 3300008421|Ga0115417_104691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2195 | Open in IMG/M |
| 3300008491|Ga0111008_124647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 645 | Open in IMG/M |
| 3300008497|Ga0111011_126188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 570 | Open in IMG/M |
| 3300008499|Ga0111012_102810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 4839 | Open in IMG/M |
| 3300008520|Ga0111044_108648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Lacrimispora → Lacrimispora saccharolytica | 3345 | Open in IMG/M |
| 3300008547|Ga0111055_133524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 658 | Open in IMG/M |
| 3300008547|Ga0111055_135988 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300008551|Ga0111058_118242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1365 | Open in IMG/M |
| 3300008561|Ga0111060_116680 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300008599|Ga0111091_124314 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300008640|Ga0111422_126872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 732 | Open in IMG/M |
| 3300008725|Ga0115670_1010217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3046 | Open in IMG/M |
| 3300008744|Ga0114025_1044347 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300008747|Ga0115677_112229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1157 | Open in IMG/M |
| 3300008750|Ga0114087_104757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3072 | Open in IMG/M |
| 3300009676|Ga0116187_1239143 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300010275|Ga0129310_1011659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3394 | Open in IMG/M |
| 3300010275|Ga0129310_1034778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1280 | Open in IMG/M |
| 3300010278|Ga0129311_1107557 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010282|Ga0129307_1082410 | Not Available | 611 | Open in IMG/M |
| 3300010283|Ga0129312_1024985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1551 | Open in IMG/M |
| 3300010345|Ga0116253_10458294 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300013459|Ga0117825_16403 | Not Available | 539 | Open in IMG/M |
| 3300013752|Ga0117817_1006190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 2770 | Open in IMG/M |
| 3300013899|Ga0117808_105142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2122 | Open in IMG/M |
| 3300013938|Ga0117797_1002020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3139 | Open in IMG/M |
| 3300013942|Ga0117795_1003121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 3054 | Open in IMG/M |
| 3300014028|Ga0117810_1032702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 879 | Open in IMG/M |
| 3300014040|Ga0117811_1075183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 652 | Open in IMG/M |
| 3300014544|Ga0134429_100883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia | 7136 | Open in IMG/M |
| 3300014549|Ga0134379_104197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3083 | Open in IMG/M |
| 3300014552|Ga0134450_108044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1658 | Open in IMG/M |
| 3300014553|Ga0134451_112639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1150 | Open in IMG/M |
| 3300014555|Ga0134422_104132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2922 | Open in IMG/M |
| 3300014570|Ga0134400_1035443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 581 | Open in IMG/M |
| 3300014573|Ga0134423_1009020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1460 | Open in IMG/M |
| 3300014573|Ga0134423_1034937 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014696|Ga0134405_105054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1571 | Open in IMG/M |
| 3300014706|Ga0135354_140618 | Not Available | 516 | Open in IMG/M |
| 3300014785|Ga0134507_1038329 | Not Available | 594 | Open in IMG/M |
| 3300014804|Ga0134371_1006768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2137 | Open in IMG/M |
| 3300014947|Ga0169813_115968 | Not Available | 915 | Open in IMG/M |
| 3300014949|Ga0134402_107229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1748 | Open in IMG/M |
| 3300018427|Ga0187903_10248391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1548 | Open in IMG/M |
| 3300019217|Ga0179946_1036329 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300019378|Ga0187901_10590326 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300023538|Ga0257033_14572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2776 | Open in IMG/M |
| 3300023719|Ga0257059_105542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | 4045 | Open in IMG/M |
| 3300026526|Ga0256869_1048431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2154 | Open in IMG/M |
| 3300029008|Ga0169638_102577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3534 | Open in IMG/M |
| 3300029008|Ga0169638_108023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium | 897 | Open in IMG/M |
| 3300029016|Ga0169614_104503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2066 | Open in IMG/M |
| 3300029019|Ga0169654_103402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3054 | Open in IMG/M |
| 3300029019|Ga0169654_106908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1680 | Open in IMG/M |
| 3300029030|Ga0169673_102962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 5197 | Open in IMG/M |
| 3300029030|Ga0169673_113310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-28 | 1505 | Open in IMG/M |
| 3300029032|Ga0169753_102143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 5680 | Open in IMG/M |
| 3300029036|Ga0169607_1033295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 859 | Open in IMG/M |
| 3300029042|Ga0169701_129897 | Not Available | 896 | Open in IMG/M |
| 3300029045|Ga0169661_105979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3059 | Open in IMG/M |
| 3300029053|Ga0169665_108245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3173 | Open in IMG/M |
| 3300029079|Ga0169227_104422 | Not Available | 1244 | Open in IMG/M |
| 3300029083|Ga0169225_102208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2975 | Open in IMG/M |
| 3300029119|Ga0168816_106691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 4508 | Open in IMG/M |
| 3300029120|Ga0168814_119722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1287 | Open in IMG/M |
| 3300029185|Ga0168712_107154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1393 | Open in IMG/M |
| 3300029195|Ga0167502_102780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium 7_1_58FAA | 5676 | Open in IMG/M |
| 3300029217|Ga0168678_106357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2928 | Open in IMG/M |
| 3300029227|Ga0168687_121543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 895 | Open in IMG/M |
| 3300029238|Ga0168766_106668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3861 | Open in IMG/M |
| 3300029246|Ga0168681_106867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3570 | Open in IMG/M |
| 3300029257|Ga0168675_125682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 605 | Open in IMG/M |
| 3300029305|Ga0307249_13249870 | Not Available | 585 | Open in IMG/M |
| 3300029322|Ga0243376_107365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1987 | Open in IMG/M |
| 3300029330|Ga0242808_126975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 718 | Open in IMG/M |
| 3300029338|Ga0243718_1065502 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300029350|Ga0243859_121026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1041 | Open in IMG/M |
| 3300029353|Ga0243845_114995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1446 | Open in IMG/M |
| 3300029354|Ga0243832_111148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1688 | Open in IMG/M |
| 3300029356|Ga0243797_109422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2235 | Open in IMG/M |
| 3300029357|Ga0243847_118453 | Not Available | 1184 | Open in IMG/M |
| 3300029360|Ga0243814_1017455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1668 | Open in IMG/M |
| 3300029371|Ga0243958_119843 | Not Available | 964 | Open in IMG/M |
| 3300029372|Ga0243963_106941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3149 | Open in IMG/M |
| 3300029414|Ga0243798_110462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1966 | Open in IMG/M |
| 3300029423|Ga0243802_110440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2304 | Open in IMG/M |
| 3300029423|Ga0243802_121138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1123 | Open in IMG/M |
| 3300029427|Ga0243889_1023487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1289 | Open in IMG/M |
| 3300029433|Ga0243761_1009445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3974 | Open in IMG/M |
| 3300029435|Ga0243745_1062140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → Mediterraneibacter faecis | 546 | Open in IMG/M |
| 3300029437|Ga0242826_1023205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1400 | Open in IMG/M |
| 3300029441|Ga0243753_1044993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 659 | Open in IMG/M |
| 3300029451|Ga0244069_102670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 2267 | Open in IMG/M |
| 3300029452|Ga0244083_102251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3216 | Open in IMG/M |
| 3300029466|Ga0244098_113033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1396 | Open in IMG/M |
| 3300029470|Ga0244172_103626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3963 | Open in IMG/M |
| 3300029485|Ga0244147_108444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 4141 | Open in IMG/M |
| 3300029488|Ga0244072_120684 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300029495|Ga0244015_1041220 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300029522|Ga0244835_1056581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 524 | Open in IMG/M |
| 3300029542|Ga0244933_123503 | Not Available | 891 | Open in IMG/M |
| 3300029546|Ga0244998_105006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3065 | Open in IMG/M |
| 3300029549|Ga0244894_102411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 11451 | Open in IMG/M |
| 3300029554|Ga0245041_126456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium | 896 | Open in IMG/M |
| 3300029571|Ga0244922_103289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → Holdemanella biformis | 9403 | Open in IMG/M |
| 3300029573|Ga0245101_125999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 994 | Open in IMG/M |
| 3300029574|Ga0243862_134144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Falcatimonas → unclassified Falcatimonas → Falcatimonas sp. MSJ-15 | 681 | Open in IMG/M |
| 3300029579|Ga0244893_150939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 547 | Open in IMG/M |
| 3300029581|Ga0244848_1047123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 712 | Open in IMG/M |
| 3300029582|Ga0245118_132157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 949 | Open in IMG/M |
| 3300029586|Ga0243865_1007300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3734 | Open in IMG/M |
| 3300029588|Ga0245111_1033476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1133 | Open in IMG/M |
| 3300029588|Ga0245111_1069351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 550 | Open in IMG/M |
| 3300029589|Ga0245106_129160 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300029617|Ga0245125_137474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Coprococcus → Coprococcus eutactus | 824 | Open in IMG/M |
| 3300029675|Ga0245254_110340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1981 | Open in IMG/M |
| 3300029684|Ga0245194_119384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 868 | Open in IMG/M |
| 3300029688|Ga0245223_120608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1133 | Open in IMG/M |
| 3300029710|Ga0245233_101809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → unclassified Erysipelotrichaceae → Erysipelotrichaceae bacterium 2_2_44A | 16646 | Open in IMG/M |
| 3300029714|Ga0245242_1009587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → unclassified Oscillibacter → Oscillibacter sp. PC13 | 3499 | Open in IMG/M |
| 3300029716|Ga0245260_1041050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 866 | Open in IMG/M |
| 3300029720|Ga0245229_1008519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 4624 | Open in IMG/M |
| 3300029730|Ga0245159_106528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2814 | Open in IMG/M |
| 3300029730|Ga0245159_130743 | Not Available | 665 | Open in IMG/M |
| 3300029734|Ga0245168_107745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2915 | Open in IMG/M |
| 3300029738|Ga0245262_131428 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300029761|Ga0243857_103059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 8689 | Open in IMG/M |
| 3300029762|Ga0245183_109744 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300029768|Ga0245196_134386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 844 | Open in IMG/M |
| 3300029778|Ga0243887_1010176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2798 | Open in IMG/M |
| 3300029778|Ga0243887_1028457 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300029789|Ga0243734_1034445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1084 | Open in IMG/M |
| 3300029791|Ga0243849_1051285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Falcatimonas → unclassified Falcatimonas → Falcatimonas sp. MSJ-15 | 743 | Open in IMG/M |
| 3300029830|Ga0245137_115692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1582 | Open in IMG/M |
| 3300029842|Ga0245273_155611 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300029858|Ga0245300_107673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 3533 | Open in IMG/M |
| 3300029858|Ga0245300_108288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3186 | Open in IMG/M |
| 7000000057|SRS013818_Baylor_scaffold_55048 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 7000000531|SRS049959_WUGC_scaffold_8710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 864 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Human | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human | 34.01% |
| Human Fecal | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal | 26.40% |
| Human Feces | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces | 13.20% |
| Human Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated | 7.61% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 4.57% |
| Human Gut | Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut | 3.05% |
| Human | Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human | 1.52% |
| Goat Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces | 1.52% |
| Western Lowland Gorilla Individual Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal | 1.52% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.52% |
| Human Gut | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut | 1.02% |
| Environmental And Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated | 0.51% |
| Human Colon Tissue | Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue | 0.51% |
| Human Lung | Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung | 0.51% |
| Primate Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal | 0.51% |
| Capybara Group Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Capybara Group Fecal | 0.51% |
| Orangutan Group Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Group Fecal | 0.51% |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.51% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559011 | Human fecal microbial communities from France, for comparison studies - Human5 (TS28 0613) | Host-Associated | Open in IMG/M |
| 3300000292 | Human fecal microbial communities from Cork, Ireland - EM305 | Host-Associated | Open in IMG/M |
| 3300000293 | Human fecal microbial communities from Cork, Ireland - EM308 | Host-Associated | Open in IMG/M |
| 3300001528 | Virome of Chimps sample 1 | Host-Associated | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300006258 | Human stool microbial communities from NIH, USA - visit 2, subject 159247771 | Host-Associated | Open in IMG/M |
| 3300006312 | Human stool microbial communities from NIH, USA - visit 2 of subject 159753524 | Host-Associated | Open in IMG/M |
| 3300006463 | Human stool microbial communities from NIH, USA - visit 2 of subject 159207311 | Host-Associated | Open in IMG/M |
| 3300006502 | Human stool microbial communities from NIH, USA - visit 1, subject 764588959 | Host-Associated | Open in IMG/M |
| 3300006568 | Human stool microbial communities from NIH, USA - visit 2 of subject 765074482 replicate 2 | Host-Associated | Open in IMG/M |
| 3300007043 | Human stool microbial communities from NIH, USA - visit 1, subject 638754422 | Host-Associated | Open in IMG/M |
| 3300007097 | Human stool microbial communities from NIH, USA - visit 2, subject 158924089 | Host-Associated | Open in IMG/M |
| 3300007108 | Human stool microbial communities from NIH, USA - visit 1, subject 160421117 | Host-Associated | Open in IMG/M |
| 3300007109 | Human stool microbial communities from NIH, USA - visit 1, subject 765620695 | Host-Associated | Open in IMG/M |
| 3300007184 | Human stool microbial communities from NIH, USA - visit 2, subject 763536994 | Host-Associated | Open in IMG/M |
| 3300007210 | Human stool microbial communities from NIH, USA - visit 1, subject 764062976 | Host-Associated | Open in IMG/M |
| 3300007292 | Human stool microbial communities from NIH, USA - visit 1, subject 765094712 reassembly | Host-Associated | Open in IMG/M |
| 3300007296 | Human stool microbial communities from NIH, USA - visit 2, subject 764184357 reassembly | Host-Associated | Open in IMG/M |
| 3300007298 | Human stool microbial communities from NIH, USA - visit 1, subject 160603188 reassembly | Host-Associated | Open in IMG/M |
| 3300007362 | Human stool microbial communities from NIH, USA - visit 1, subject 675950834 reassembly | Host-Associated | Open in IMG/M |
| 3300007524 | Human stool microbial communities from NIH, USA - visit 1, subject 763496533 reassembly | Host-Associated | Open in IMG/M |
| 3300007650 | Human stool microbial communities from NIH, USA - visit 1, subject 604812005 reassembly | Host-Associated | Open in IMG/M |
| 3300007669 | Human stool microbial communities from NIH, USA - visit 2, subject 158256496 reassembly | Host-Associated | Open in IMG/M |
| 3300007714 | Human stool microbial communities from NIH, USA - visit 2, subject 763678604 reassembly | Host-Associated | Open in IMG/M |
| 3300007717 | Human stool microbial communities from NIH, USA - visit 2, subject 159551223 reassembly | Host-Associated | Open in IMG/M |
| 3300007742 | Human stool microbial communities from NIH, USA - visit 1, subject 763577454 reassembly | Host-Associated | Open in IMG/M |
| 3300007801 | Human stool microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly | Host-Associated | Open in IMG/M |
| 3300007802 | Human stool microbial communities from NIH, USA - visit 2, subject 159268001 reassembly | Host-Associated | Open in IMG/M |
| 3300007804 | Human stool microbial communities from NIH, USA - visit 2, subject 159814214 reassembly | Host-Associated | Open in IMG/M |
| 3300007805 | Human stool microbial communities from NIH, USA - visit 1, subject 508703490 reassembly | Host-Associated | Open in IMG/M |
| 3300008060 | Human stool microbial communities from NIH, USA - visit 1, subject 159227541 reassembly | Host-Associated | Open in IMG/M |
| 3300008077 | Human stool microbial communities from NIH, USA - visit 1, subject 763860675 reassembly | Host-Associated | Open in IMG/M |
| 3300008096 | Human stool microbial communities from NIH, USA - visit 1, subject 765701615 reassembly | Host-Associated | Open in IMG/M |
| 3300008101 | Human stool microbial communities from NIH, USA - visit 2, subject 159227541 reassembly | Host-Associated | Open in IMG/M |
| 3300008103 | Human stool microbial communities from NIH, USA - visit 2, subject 764892411 reassembly | Host-Associated | Open in IMG/M |
| 3300008129 | Human stool microbial communities from NIH, USA - visit 2, subject 765094712 reassembly | Host-Associated | Open in IMG/M |
| 3300008272 | Human stool microbial communities from NIH, USA - visit 1, subject 158337416 reassembly | Host-Associated | Open in IMG/M |
| 3300008301 | Human stool microbial communities from NIH, USA - visit 1, subject 763820215 reassembly | Host-Associated | Open in IMG/M |
| 3300008306 | Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764305738 reassembly | Host-Associated | Open in IMG/M |
| 3300008326 | Human stool microbial communities from NIH, USA - visit 1, subject 158458797 reassembly | Host-Associated | Open in IMG/M |
| 3300008361 | Human stool microbial communities from NIH, USA - visit 1, subject 764325968 reassembly | Host-Associated | Open in IMG/M |
| 3300008404 | Human stool microbial communities from NIH, USA - visit 2, subject 764002286 reassembly | Host-Associated | Open in IMG/M |
| 3300008421 | Human stool microbial communities from NIH, USA - visit 1, subject 763961826 reassembly | Host-Associated | Open in IMG/M |
| 3300008491 | Human stool microbial communities from NIH, USA - visit 1, subject 159814214 reassembly | Host-Associated | Open in IMG/M |
| 3300008497 | Human stool microbial communities from NIH, USA - visit 1, subject 404239096 reassembly | Host-Associated | Open in IMG/M |
| 3300008499 | Human stool microbial communities from NIH, USA - visit 1, subject 159490532 reassembly | Host-Associated | Open in IMG/M |
| 3300008520 | Human stool microbial communities from NIH, USA - visit 1, subject 764487809 reassembly | Host-Associated | Open in IMG/M |
| 3300008547 | Human stool microbial communities from NIH, USA - visit 1, subject 159733294 reassembly | Host-Associated | Open in IMG/M |
| 3300008551 | Human stool microbial communities from NIH, USA - visit 1, subject 158802708 reassembly | Host-Associated | Open in IMG/M |
| 3300008561 | Human stool microbial communities from NIH, USA - visit 2, subject 159713063 reassembly | Host-Associated | Open in IMG/M |
| 3300008599 | Human stool microbial communities from NIH, USA - visit 1, subject 158742018 reassembly | Host-Associated | Open in IMG/M |
| 3300008640 | Human stool microbial communities from NIH, USA - visit 2, subject 763901136 reassembly | Host-Associated | Open in IMG/M |
| 3300008725 | Human stool microbial communities from NIH, USA - visit 1, subject 763678604 reassembly | Host-Associated | Open in IMG/M |
| 3300008744 | Human stool microbial communities from NIH, USA - visit 2, subject 763496533 reassembly | Host-Associated | Open in IMG/M |
| 3300008747 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763982056 reassembly | Host-Associated | Open in IMG/M |
| 3300008750 | Human stool microbial communities from NIH, USA - visit 2, subject 159005010 reassembly | Host-Associated | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300010275 | Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022A metagenome | Host-Associated | Open in IMG/M |
| 3300010278 | Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022B metagenome | Host-Associated | Open in IMG/M |
| 3300010282 | Capybara group fecal microbial communities from Wisconsin, USA - P1105 metagenome | Host-Associated | Open in IMG/M |
| 3300010283 | Orangutan group fecal microbial communities from Wisconsin, USA - O827 metagenome | Host-Associated | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300013459 | Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-2A-St-MgMD-nonhuman | Host-Associated | Open in IMG/M |
| 3300013752 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 288 | Host-Associated | Open in IMG/M |
| 3300013899 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 294 | Host-Associated | Open in IMG/M |
| 3300013938 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 235 | Host-Associated | Open in IMG/M |
| 3300013942 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 150 | Host-Associated | Open in IMG/M |
| 3300014028 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 32 | Host-Associated | Open in IMG/M |
| 3300014040 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 352 | Host-Associated | Open in IMG/M |
| 3300014544 | Human fecal microbial communities from obese patients in Germany - AS65_24 | Host-Associated | Open in IMG/M |
| 3300014549 | Human fecal microbial communities from obese patients in Germany - AS51_0 | Host-Associated | Open in IMG/M |
| 3300014552 | Human fecal microbial communities from obese patients in Germany - AS56_6 | Host-Associated | Open in IMG/M |
| 3300014553 | Human fecal microbial communities from obese patients in Germany - AS58_6 | Host-Associated | Open in IMG/M |
| 3300014555 | Human fecal microbial communities from obese patients in Germany - AS56_24 | Host-Associated | Open in IMG/M |
| 3300014570 | Human fecal microbial communities from obese patients in Germany - AS63_12 | Host-Associated | Open in IMG/M |
| 3300014573 | Human fecal microbial communities from obese patients in Germany - AS58_24 | Host-Associated | Open in IMG/M |
| 3300014696 | Human fecal microbial communities from obese patients in Germany - AS44_18 | Host-Associated | Open in IMG/M |
| 3300014706 | Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0995 | Host-Associated | Open in IMG/M |
| 3300014785 | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P788T2 | Host-Associated | Open in IMG/M |
| 3300014804 | Human fecal microbial communities from obese patients in Germany - AS66_12 | Host-Associated | Open in IMG/M |
| 3300014947 | Human fecal microbial communities from infant at 12 months in Denmark - 589_12M | Host-Associated | Open in IMG/M |
| 3300014949 | Human fecal microbial communities from obese patients in Germany - AS65_12 | Host-Associated | Open in IMG/M |
| 3300018427 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
| 3300019217 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019378 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
| 3300023538 | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_148A | Host-Associated | Open in IMG/M |
| 3300023719 | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_93C | Host-Associated | Open in IMG/M |
| 3300026526 | Metatranscriptome of bovine rumen microbial communities from Lethbridge, Alberta, Canada - Rumen RJG_05 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300029008 | Human fecal microbial communities from infant at 12 months in Denmark - 326_12M | Host-Associated | Open in IMG/M |
| 3300029016 | Human fecal microbial communities from infant at 12 months in Denmark - 272_12M | Host-Associated | Open in IMG/M |
| 3300029019 | Human fecal microbial communities from infant at 12 months in Denmark - 341_12M | Host-Associated | Open in IMG/M |
| 3300029030 | Human fecal microbial communities from mother in Denmark - 367_M | Host-Associated | Open in IMG/M |
| 3300029032 | Human fecal microbial communities from mother in Denmark - 532_M | Host-Associated | Open in IMG/M |
| 3300029036 | Human fecal microbial communities from mother in Denmark - 265_M | Host-Associated | Open in IMG/M |
| 3300029042 | Human fecal microbial communities from mother in Denmark - 39_M | Host-Associated | Open in IMG/M |
| 3300029045 | Human fecal microbial communities from mother in Denmark - 343_M | Host-Associated | Open in IMG/M |
| 3300029053 | Human fecal microbial communities from mother in Denmark - 345_M | Host-Associated | Open in IMG/M |
| 3300029079 | Human fecal microbial communities from infant at 4 months in Denmark - 181_4M | Host-Associated | Open in IMG/M |
| 3300029083 | Human fecal microbial communities from infant at 12 months in Denmark - 181_12M | Host-Associated | Open in IMG/M |
| 3300029119 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021211-26 | Host-Associated | Open in IMG/M |
| 3300029120 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021209-24 | Host-Associated | Open in IMG/M |
| 3300029185 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012056-15 | Host-Associated | Open in IMG/M |
| 3300029195 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021314-123 | Host-Associated | Open in IMG/M |
| 3300029217 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002661-50 | Host-Associated | Open in IMG/M |
| 3300029227 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002670-43 | Host-Associated | Open in IMG/M |
| 3300029238 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019821-26 | Host-Associated | Open in IMG/M |
| 3300029246 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002664-33 | Host-Associated | Open in IMG/M |
| 3300029257 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002658-45 | Host-Associated | Open in IMG/M |
| 3300029305 | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples. | Host-Associated | Open in IMG/M |
| 3300029322 | Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-59_Run3 | Host-Associated | Open in IMG/M |
| 3300029330 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 009_6_3_stool_1 | Host-Associated | Open in IMG/M |
| 3300029338 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 024_10_24_stool_1 | Host-Associated | Open in IMG/M |
| 3300029350 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_11_stool_2 | Host-Associated | Open in IMG/M |
| 3300029353 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_13_stool_1 | Host-Associated | Open in IMG/M |
| 3300029354 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 047_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029356 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029357 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029360 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 045_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029371 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029372 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_5_2_stool_2 | Host-Associated | Open in IMG/M |
| 3300029414 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_2 | Host-Associated | Open in IMG/M |
| 3300029423 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_30_stool_2 | Host-Associated | Open in IMG/M |
| 3300029427 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 074_4_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029433 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029435 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 027_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029437 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_2 | Host-Associated | Open in IMG/M |
| 3300029441 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 029_10_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029451 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001823-33 | Host-Associated | Open in IMG/M |
| 3300029452 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001838-81 | Host-Associated | Open in IMG/M |
| 3300029466 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001853-104 | Host-Associated | Open in IMG/M |
| 3300029470 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001930-17 | Host-Associated | Open in IMG/M |
| 3300029485 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001905-95 | Host-Associated | Open in IMG/M |
| 3300029488 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001827-39 | Host-Associated | Open in IMG/M |
| 3300029495 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 098_4_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029522 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012170-74 | Host-Associated | Open in IMG/M |
| 3300029542 | Human fecal microbial communities from Shanghai, China - P040V1 | Host-Associated | Open in IMG/M |
| 3300029546 | Human fecal microbial communities from Shanghai, China - P089V6 | Host-Associated | Open in IMG/M |
| 3300029549 | Human fecal microbial communities from Shanghai, China - P017V6 | Host-Associated | Open in IMG/M |
| 3300029554 | Human fecal microbial communities from Shanghai, China - P112V1 | Host-Associated | Open in IMG/M |
| 3300029571 | Human fecal microbial communities from Shanghai, China - P034V6 | Host-Associated | Open in IMG/M |
| 3300029573 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35515 | Host-Associated | Open in IMG/M |
| 3300029574 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_14_stool_1 | Host-Associated | Open in IMG/M |
| 3300029579 | Human fecal microbial communities from Shanghai, China - P017V1 | Host-Associated | Open in IMG/M |
| 3300029581 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI021992-23 | Host-Associated | Open in IMG/M |
| 3300029582 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35666 | Host-Associated | Open in IMG/M |
| 3300029586 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029588 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35578 | Host-Associated | Open in IMG/M |
| 3300029589 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35549 | Host-Associated | Open in IMG/M |
| 3300029617 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35739 | Host-Associated | Open in IMG/M |
| 3300029675 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37200R1 | Host-Associated | Open in IMG/M |
| 3300029684 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37269 | Host-Associated | Open in IMG/M |
| 3300029688 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35562 | Host-Associated | Open in IMG/M |
| 3300029710 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36051 | Host-Associated | Open in IMG/M |
| 3300029714 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36525 | Host-Associated | Open in IMG/M |
| 3300029716 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37228 | Host-Associated | Open in IMG/M |
| 3300029720 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35989 | Host-Associated | Open in IMG/M |
| 3300029730 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36666 | Host-Associated | Open in IMG/M |
| 3300029734 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36981 | Host-Associated | Open in IMG/M |
| 3300029738 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37264 | Host-Associated | Open in IMG/M |
| 3300029761 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_10_stool_1 | Host-Associated | Open in IMG/M |
| 3300029762 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37193R1 | Host-Associated | Open in IMG/M |
| 3300029768 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37277 | Host-Associated | Open in IMG/M |
| 3300029778 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 074_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029789 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 026_10_28_stool_2 | Host-Associated | Open in IMG/M |
| 3300029791 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_11_stool_1 | Host-Associated | Open in IMG/M |
| 3300029830 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36034 | Host-Associated | Open in IMG/M |
| 3300029842 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35636 | Host-Associated | Open in IMG/M |
| 3300029858 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37314 | Host-Associated | Open in IMG/M |
| 7000000057 | Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159571453 | Host-Associated | Open in IMG/M |
| 7000000531 | Human stool microbial communities from NIH, USA - visit 1, subject 765701615 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Human5-_01912930 | 2166559011 | Environmental And Host-Associated | CCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| EM305_10030473 | 3300000292 | Human Fecal | QTVCQNRLRAASPQGIAALAAQGGVATLTERSDETFSVMQYPPADRE* |
| EM308_10019104 | 3300000293 | Human Fecal | SILCCLRTASPQGIDAQAAQGGVATLTERSDETFSVVQFSSADRE* |
| chfe1id_100332792 | 3300001528 | Primate Fecal | TASPQGIDAQASQGSVAPLTERSDEAFLVMQFSSADGE* |
| JGI24707J26582_102114452 | 3300002163 | Biogas Fermentantion | PQGIDAQASQGSVSPLTERSDETFSVMQFSSADRE* |
| Ga0099398_1044324 | 3300006258 | Human | RTVCQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0099398_1066403 | 3300006258 | Human | LRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE* |
| Ga0099398_1100201 | 3300006258 | Human | LRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0099626_1041371 | 3300006312 | Human | TASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0100176_10085641 | 3300006463 | Human | QGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0100176_10236391 | 3300006463 | Human | NSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0100528_1279031 | 3300006502 | Human | CLRTASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0100215_10066957 | 3300006568 | Human | CQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0102536_1070661 | 3300007043 | Human | GTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0102537_1057513 | 3300007097 | Human | VPVGMAVLGVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0102537_1092191 | 3300007097 | Human | SPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE* |
| Ga0102731_1088263 | 3300007108 | Human | NSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0102633_1064071 | 3300007109 | Human | CLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0102633_1131184 | 3300007109 | Human | PQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0102633_1395842 | 3300007109 | Human | PQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0103258_1067701 | 3300007184 | Human | VFGFSNLLATNSISCCLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0103258_1116034 | 3300007184 | Human | NRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0103258_1193832 | 3300007184 | Human | ASTQGIAAQAAQGGVATLTEGRDETCSVGQFFSADRE* |
| Ga0103359_1191481 | 3300007210 | Human | WTASLQGIAALAAQGGVATLTERSNATFSVKQFLSADRE* |
| Ga0103359_1224194 | 3300007210 | Human | ASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0104320_1035411 | 3300007292 | Human | ASTQGIAALAAQGGVATLTERSDETFSVMQLFSADRE* |
| Ga0104320_1037051 | 3300007292 | Human | TQGIAALAAQGGVATLTERSDETFSVEQFSSADRK* |
| Ga0104830_1058991 | 3300007296 | Human | AANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0104838_1070311 | 3300007298 | Human | NSLRTASPQGIAALAAQGGVATLTERSDATFSVMQLFSADRE* |
| Ga0104788_1072041 | 3300007362 | Human | RRTVCQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0104788_1155463 | 3300007362 | Human | CCLRTASTQGIVALAAQGGVATLTEQSDATFSVVQFSSADRE* |
| Ga0105481_10214221 | 3300007524 | Human | ASPRGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0105532_1040075 | 3300007650 | Human | RTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0105546_1086401 | 3300007669 | Human | TASPQGIDAQASQGSVAPLMERSDETFSGMQLFSADRE* |
| Ga0105661_10205903 | 3300007714 | Human | SPQGIAALAAQGGVATLTERSDATFSVMQYPPADGE* |
| Ga0105661_10476353 | 3300007714 | Human | ANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0105662_1197191 | 3300007717 | Human | TASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE* |
| Ga0105758_10433601 | 3300007742 | Human | ASPQGIAALAAQGGVATLTERSDEIFPVGQFSSADRE* |
| Ga0105807_1050506 | 3300007801 | Human | RRTVCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0105667_1256441 | 3300007802 | Human | QTVCQNRLRTASPQGIAAQASQGGVATLTERSDATFSVMQYPPADGE* |
| Ga0105665_1033045 | 3300007804 | Human | TASPQGIAALAAQGGVATLTERSDATFSVEQFSSADRE* |
| Ga0105637_1039901 | 3300007805 | Human | GGRRVWGAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0114177_1075251 | 3300008060 | Human | LRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0105964_10074301 | 3300008077 | Human | SNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0114155_10164151 | 3300008096 | Human | SPQGIAALAAQGGVATLTERSDATFSVEQFSSADRE* |
| Ga0114155_10181245 | 3300008096 | Human | QTVCQNRLRTASPQGIAALAAQGGVATLTEGRDETCSVKQFSSADGE* |
| Ga0114024_1179653 | 3300008101 | Human | GPEGMAALAAQGGVATLTERSDATFSVEQFSSADRE* |
| Ga0114180_1072721 | 3300008103 | Human | QNRLRTASTQGIVALAAQGGVATLTEQSDATFSVMQLFSADRE* |
| Ga0114848_1032075 | 3300008129 | Human | QGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0114848_1105241 | 3300008129 | Human | ILCCLRTASPQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
| Ga0111092_10177501 | 3300008272 | Human | RLQTASPQGIDAQASQGSVAPLTERSVETFSVGQFSSADRE* |
| Ga0111092_10257143 | 3300008272 | Human | TVCQTRLRTASLQGIAALAAQGGVATLTERSNATFSVKQFLSADRE* |
| Ga0114871_1013476 | 3300008301 | Human | VFSNLLAANSISCCLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0115184_10064561 | 3300008306 | Human | SPQGIAALASQGSVAPLTEQSDATFSVGQFSSADRE* |
| Ga0115311_1289442 | 3300008326 | Human | SILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0115082_1046321 | 3300008361 | Human | TASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0115082_1176171 | 3300008361 | Human | QNRLRTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE* |
| Ga0115185_1043941 | 3300008404 | Human | QGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0115417_1046911 | 3300008421 | Human | ASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0111008_1246471 | 3300008491 | Human | TASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0111011_1261881 | 3300008497 | Human | CLQTASPQGIAAQASQGGVATLTERSDETFSVEQFSSADRK* |
| Ga0111012_1028106 | 3300008499 | Human | NLLAANSILCCLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0111044_1086481 | 3300008520 | Human | RLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0111055_1335242 | 3300008547 | Human | PQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0111055_1359882 | 3300008547 | Human | LAANSILCCLRTASPQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
| Ga0111058_1182424 | 3300008551 | Human | SVFVFPNLLAANSILCCLRTASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE* |
| Ga0111060_1166802 | 3300008561 | Human | CFLRTASPQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
| Ga0111091_1243143 | 3300008599 | Human | ANSILCCLRTASTQGIAALAAQGGVATLTERSDETFTVMQLFSADRE* |
| Ga0111422_1268721 | 3300008640 | Human | LRTASPQGIAALAAQGGVATLTERSDETCSVEQFSSADRE* |
| Ga0115670_10102171 | 3300008725 | Human | ASPQGIDAQASQGSVAPLMERSDETFSGMQLFSADRE* |
| Ga0114025_10443471 | 3300008744 | Human | RTASPQGIAALAAQGGVATLTERSDAAFEVCQFSSADRE* |
| Ga0115677_1122294 | 3300008747 | Human | LAGGEQHLCCLRTASPQGIDAQASQGSVAPLTEQSDETFSVGQFSSADRE* |
| Ga0114087_1047574 | 3300008750 | Human | RRTVCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0116187_12391431 | 3300009676 | Anaerobic Digestor Sludge | HALQNQYFPVPNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDETFSVWQFLSADGE* |
| Ga0129310_10116591 | 3300010275 | Western Lowland Gorilla Individual Fecal | SPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0129310_10347781 | 3300010275 | Western Lowland Gorilla Individual Fecal | NRLRTASPQGIAALAAQGGVATLTERSDATFSVMQYPPADGE* |
| Ga0129311_11075572 | 3300010278 | Western Lowland Gorilla Individual Fecal | NLLAANSILCCLRTASPQGIAALAVQGGVAPLTEQSDETFSVGRFFSADRE* |
| Ga0129307_10824102 | 3300010282 | Capybara Group Fecal | LRTASPQGIAALAAQGGVATLTEQSDRAFSVKQFSAEIE* |
| Ga0129312_10249854 | 3300010283 | Orangutan Group Fecal | AANSILCCLRTASPQGIAALAAQGGVATLTERSEEAFSVKQFSSVDGK* |
| Ga0116253_104582941 | 3300010345 | Anaerobic Digestor Sludge | LRTASPQGIAALAAQGGVATLTERSDETFSVWQFLSADGE* |
| Ga0117825_164032 | 3300013459 | Human Lung | GLIFSIRFFKLAGGEQHLCCLRTASPQGIAALASQGSVAPLTEQSDATFSVGQFSSADRE |
| Ga0117817_10061905 | 3300013752 | Human Gut | RWRPESPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0117808_1051423 | 3300013899 | Human Gut | QGIAALAAQGGVATLTERSDATFSVEQFSSADRE* |
| Ga0117797_10020201 | 3300013938 | Human Gut | SPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0117795_10031215 | 3300013942 | Human Gut | ASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| Ga0117810_10327021 | 3300014028 | Human Gut | LLAANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSAD |
| Ga0117811_10751831 | 3300014040 | Human Gut | EGRRVLAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0134429_1008831 | 3300014544 | Human Fecal | QNRLRTASPQGIAALAAQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0134379_1041971 | 3300014549 | Human Fecal | ILCCLRTASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE* |
| Ga0134450_1080445 | 3300014552 | Human Fecal | LLAADGSQNRLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE |
| Ga0134451_1126393 | 3300014553 | Human Fecal | CKTVWRTASPQGIAALAAQGGVATLTERSDATFSVVQFSSADRE* |
| Ga0134422_1041321 | 3300014555 | Human Fecal | ISCCLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE* |
| Ga0134400_10354431 | 3300014570 | Human Fecal | ASPQGIDAQASQGSVAPLTERSDETFSVEQFSSADWE* |
| Ga0134423_10090203 | 3300014573 | Human Fecal | CQNRLRTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE* |
| Ga0134423_10349371 | 3300014573 | Human Fecal | PQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
| Ga0134405_1050541 | 3300014696 | Human Fecal | ASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0135354_1406181 | 3300014706 | Human Colon Tissue | NSISCCLRTASPQGIAALAAQGGVATLTERSDATFSVEQFSSADRE* |
| Ga0134507_10383292 | 3300014785 | Human Fecal | TQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0134371_10067681 | 3300014804 | Human Fecal | PQGIAALAAQGGVATLTERSDETCSVEQFSSADRE* |
| Ga0169813_1159681 | 3300014947 | Human Host-Associated | LCCLRTASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0134402_1072291 | 3300014949 | Human Fecal | VCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| Ga0187903_102483913 | 3300018427 | Goat Feces | LLAANGLSKRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0179946_10363293 | 3300019217 | Anaerobic Digestor Sludge | QNQYFPVPNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDETFSVWQFLSADGE |
| Ga0187901_105903262 | 3300019378 | Goat Feces | FSFTNLLAANGLSKRLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0257033_145721 | 3300023538 | Human Gut | LRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0257059_1055426 | 3300023719 | Human Gut | PQGIAALAAQGGVATLTERSDATFSVGQFSSADRE |
| Ga0256869_10484312 | 3300026526 | Rumen | LLAADGSQNRLRTASPQGIDAQASQGSVAPLTERSDEIFSVKQFFSADRE |
| Ga0169638_1025771 | 3300029008 | Human Host-Associated | ASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0169638_1080232 | 3300029008 | Human Host-Associated | SPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0169614_1045036 | 3300029016 | Human Host-Associated | ILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0169654_1034021 | 3300029019 | Human Host-Associated | PQGIAALAAQGGVATLTERSDATFSVKQFSSADRE |
| Ga0169654_1069081 | 3300029019 | Human Host-Associated | RTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0169673_1029621 | 3300029030 | Human Host-Associated | SPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0169673_1133103 | 3300029030 | Human Host-Associated | SPQGIAALAAQGGVATLTERSDATFFVGQFSSADRE |
| Ga0169753_1021431 | 3300029032 | Human Host-Associated | TASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0169607_10332953 | 3300029036 | Human Host-Associated | TVCQNRLRTASPQGIDAQAAQGGVATLTGRSDETFLVEQFSSADRE |
| Ga0169701_1298972 | 3300029042 | Human Host-Associated | RRTVCQNRLRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0169661_1059791 | 3300029045 | Human Host-Associated | RTASPQGIDAQASQGSVAPLMERSDETFSGMQLFSADRE |
| Ga0169665_1082451 | 3300029053 | Human Host-Associated | RTVCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0169227_1044221 | 3300029079 | Human Host-Associated | ASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0169225_1022084 | 3300029083 | Human Host-Associated | ILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQLFSADRE |
| Ga0168816_1066917 | 3300029119 | Host-Associated | LRTASPQGIAALAAQGGVATLTEGRDETFSVGQFSSADRE |
| Ga0168814_1197223 | 3300029120 | Host-Associated | LRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0168712_1071543 | 3300029185 | Host-Associated | PQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0167502_1027805 | 3300029195 | Host-Associated | LLNYRLLFSNLLAANGLSKPFADGKSTGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0168678_1063575 | 3300029217 | Host-Associated | RTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE |
| Ga0168687_1215432 | 3300029227 | Host-Associated | ASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE |
| Ga0168766_1066684 | 3300029238 | Host-Associated | TASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE |
| Ga0168681_1068671 | 3300029246 | Host-Associated | NSISCCLRTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE |
| Ga0168675_1256822 | 3300029257 | Host-Associated | LLAANSISCCLRTASPQGIDAQASQGSVAPLMERSDETFSVMQLFSADRE |
| Ga0307249_132498701 | 3300029305 | Goat Feces | LRTASPQGIAALAAQGGVATLTERSDATFEVMQFSSADENE |
| Ga0243376_1073651 | 3300029322 | Human Fecal | CCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0242808_1269752 | 3300029330 | Human Feces | RTASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE |
| Ga0243718_10655021 | 3300029338 | Human Feces | TVCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0243859_1210261 | 3300029350 | Human Feces | PSNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDETFPVGQFSSADRE |
| Ga0243845_1149951 | 3300029353 | Human Feces | CQNRLRTASPQGIAALAAQGGVATLAERSDATFSVMQFSSADGE |
| Ga0243832_1111481 | 3300029354 | Human Feces | ASPQGIAALAAQGGVATLTERSDATFSVKQFSSADRE |
| Ga0243797_1094224 | 3300029356 | Human Feces | CQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0243847_1184532 | 3300029357 | Human Feces | FIFSNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDETFSVMQFLSADRE |
| Ga0243814_10174551 | 3300029360 | Human Feces | GSQNRLRTASPQGIDAQASQGSVAPLTERSDETFSVMQPFSADRE |
| Ga0243958_1198432 | 3300029371 | Human Feces | FSNLLAANSISCCLRTASPQGIDAQASQGSVAPLTEQSDETFSVGQFSSADRE |
| Ga0243963_1069411 | 3300029372 | Human Feces | NSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADRE |
| Ga0243798_1104621 | 3300029414 | Human Feces | QNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0243802_1104401 | 3300029423 | Human Feces | VCQNRLRTASPQGIAALAVQGGVATLTERSDATFSVKQFSSADGE |
| Ga0243802_1211383 | 3300029423 | Human Feces | ANSILCCLRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0243889_10234871 | 3300029427 | Human Feces | CWRRTVCQNRLRTASPQGIAALAVQGGVATLTERSDETFSVMQPFSADRE |
| Ga0243761_10094455 | 3300029433 | Human Feces | VCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0243745_10621402 | 3300029435 | Human Feces | NLLAADGSQNRLRTASPQGIDAQASQGSVAPLTERSDETFSVMQPFSADRE |
| Ga0242826_10232051 | 3300029437 | Human Feces | FCQNRLRTASTQGIVALAAQGGVATLTEQSDATFSVMQLFSADRE |
| Ga0243753_10449932 | 3300029441 | Human Feces | SPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE |
| Ga0244069_1026706 | 3300029451 | Human Fecal | RTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADRE |
| Ga0244083_1022511 | 3300029452 | Human Fecal | PFYSPSNLLAANSILCCLRTASPQGIDALAAQGGVATLTERSDATFSVEQFSSADRE |
| Ga0244098_1130332 | 3300029466 | Human Fecal | TASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0244172_1036261 | 3300029470 | Human Fecal | TVCQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQLFSADRE |
| Ga0244147_1084445 | 3300029485 | Human Fecal | RTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0244072_1206842 | 3300029488 | Human Fecal | TQGIAALAAQGGVATLTERSDETFSVMQLFSADRE |
| Ga0244015_10412201 | 3300029495 | Human Feces | LRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0244835_10565812 | 3300029522 | Human Fecal | VCQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0244933_1235031 | 3300029542 | Human Fecal | TASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0244998_1050061 | 3300029546 | Human Fecal | CQNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADWE |
| Ga0244894_10241113 | 3300029549 | Human Fecal | LLAADVSQNRLRTASPQGIAALAAQGGVAPLTEGRDETFSLGQFSSADRE |
| Ga0245041_1264562 | 3300029554 | Human Fecal | RTASPQGIAALAAQGGVATLTERSDATFSVEQFSSADRE |
| Ga0244922_1032891 | 3300029571 | Human Fecal | NLLATNSISCCLRTASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE |
| Ga0245101_1259993 | 3300029573 | Human Fecal | LLAANSILCCLRTASPQGIAALAAQVGVATLTERSDATFSVMQFSSADRE |
| Ga0243862_1341442 | 3300029574 | Human Feces | ILCCLRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0244893_1509391 | 3300029579 | Human Fecal | CRPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE |
| Ga0244848_10471233 | 3300029581 | Human Fecal | RTASPQGIDAQASQGGVAPLTEQSDATFSVMQYPPADGE |
| Ga0245118_1321571 | 3300029582 | Human Fecal | LRTASPQGIAALAAQGGVATLTERSDVTFSVMQYPPADGE |
| Ga0243865_100730010 | 3300029586 | Human Feces | ANSILCCLRTASPQGIAALAAQGGVATLTERSDETFPVGQFSSADRE |
| Ga0245111_10334761 | 3300029588 | Human Fecal | ASPQGIAALAAQGGVATLTEGRDEIFSVRQFSSADRE |
| Ga0245111_10693511 | 3300029588 | Human Fecal | AANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0245106_1291602 | 3300029589 | Human Fecal | TASPQGIAALAAQGGVATLTERSDAAFEVCQFSSADRE |
| Ga0245125_1374741 | 3300029617 | Human Fecal | RTASPQGIAALAAQGGVATLTERSDETFTVGQFSSANRE |
| Ga0245254_1103404 | 3300029675 | Human Fecal | RLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| Ga0245194_1193843 | 3300029684 | Human Fecal | TVCQNRLRTASPQGIAALAAQGGVATLTERSDETFSVMQFSSADGE |
| Ga0245223_1206083 | 3300029688 | Human Fecal | CCLRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0245233_10180921 | 3300029710 | Human Fecal | RTTSPQGIAALAAQGGVATLTERSDATFSVMQFSSADRE |
| Ga0245242_10095871 | 3300029714 | Human Fecal | LLAANSILCCLRTASPQGIDAQAAQGSVAPLTERSDETFSVGQFFSADRE |
| Ga0245260_10410501 | 3300029716 | Human Fecal | ASPQGIAALAAQGGVATLTERSDATFSVVQFSSADRE |
| Ga0245229_10085191 | 3300029720 | Human Fecal | ASPQGIDAQASQGSVAPLTEQSDETFSVGQFSSADRE |
| Ga0245159_1065281 | 3300029730 | Human Fecal | FSNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0245159_1307431 | 3300029730 | Human Fecal | VFYLLAANSILCCLQTASPQEIDAQASQGSVAPLTERSDETFSVKQFFSADRE |
| Ga0245168_1077455 | 3300029734 | Human Fecal | SFSNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVEQFSSADRE |
| Ga0245262_1314283 | 3300029738 | Human Fecal | SNLLAANSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| Ga0243857_1030591 | 3300029761 | Human Feces | CCLRTASPQGIAALAAQGGVATLTERSDETFPVGQFSSADRE |
| Ga0245183_1097441 | 3300029762 | Human Fecal | RTASPQGIDAQASQGSVAPLTERSDETFSVKQFFSADRE |
| Ga0245196_1343861 | 3300029768 | Human Fecal | RLRTASPQGIAALAAQGGVATLTERSDATFSVVQFSSADRE |
| Ga0243887_10101765 | 3300029778 | Human Feces | RLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| Ga0243887_10284574 | 3300029778 | Human Feces | SPQGIAALAAQGGVATLTEGRDATFSVEQFSSADRE |
| Ga0243734_10344454 | 3300029789 | Human Feces | CQNRLQTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0243849_10512851 | 3300029791 | Human Feces | LRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE |
| Ga0245137_1156922 | 3300029830 | Human Fecal | CCLRTASPQGIDAQASQGSVAPLTERSDETFSVGQFSSADWE |
| Ga0245273_1556111 | 3300029842 | Human Fecal | PQGIAALAAQGSVATLTERSDETFPVGQFSSADRE |
| Ga0245300_1076732 | 3300029858 | Human Fecal | XQGIAALAAQGGVATLTEQSDATFSVMQLFSADRE |
| Ga0245300_1082881 | 3300029858 | Human Fecal | CQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE |
| SRS013818_Baylor_scaffold_55048__gene_69153 | 7000000057 | Human | PQGIAALASQGSVAPLTEQSDATFSVGQFSSANRE |
| SRS049959_WUGC_scaffold_8710__gene_16455 | 7000000531 | Human | LLAANSILCCLRTASTQGIVALAAQGGVATLTEQSDATFSVVQFSSADR |
| ⦗Top⦘ |