| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029437 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281942 | Ga0242826 |
| Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 252700959 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F056682 | Metagenome | 137 | Y |
| F070093 | Metagenome | 123 | N |
| F076189 | Metagenome | 118 | N |
| F081354 | Metagenome | 114 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0242826_1002463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 15020 | Open in IMG/M |
| Ga0242826_1005975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 6004 | Open in IMG/M |
| Ga0242826_1012376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2741 | Open in IMG/M |
| Ga0242826_1023205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1400 | Open in IMG/M |
| Ga0242826_1033198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 967 | Open in IMG/M |
| Ga0242826_1045514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 698 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0242826_1002463 | Ga0242826_100246318 | F026489 | NQKSASDFDALEPRKRGCTPLLTPKQWATPEKTEDSRLFGVKIF |
| Ga0242826_1005975 | Ga0242826_10059752 | F081354 | LVRENQQSSAHNFVKDFSSIYPESRRRSPLKKGAVTEIPLEYGKTEVQIPFEPLQAAISSMELPKNFENKKLPNPLR |
| Ga0242826_1012376 | Ga0242826_10123764 | F070093 | GVCRVSNFESLLLAEFYPFRIDPPMKPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
| Ga0242826_1023205 | Ga0242826_10232051 | F026592 | FCQNRLRTASTQGIVALAAQGGVATLTEQSDATFSVMQLFSADRE |
| Ga0242826_1033198 | Ga0242826_10331982 | F076189 | VLSAGHCFFLSPFIKPLLYVEKLQIGTVLPVVPDLYREFAELLACFDLHAIQSAQKPLHMLCNFHENTLGLLIFYTNYAII |
| Ga0242826_1045514 | Ga0242826_10455143 | F056682 | QNTMKMQSRAGKAANQPIRQGEIYSASFGAFPSKNRSTFPIQELRKNREDQEVL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |