


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006258 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052819 | Ga0099398 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 2, subject 159247771 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 83659129 |
| Sequencing Scaffolds | 9 |
| Novel Protein Genes | 9 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F042936 | Metagenome | 157 | N |
| F044554 | Metagenome | 154 | N |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F047126 | Metagenome | 150 | N |
| F067845 | Metagenome | 125 | N |
| F089054 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0099398_100135 | Not Available | 83535 | Open in IMG/M |
| Ga0099398_101558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 10636 | Open in IMG/M |
| Ga0099398_101615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 10172 | Open in IMG/M |
| Ga0099398_102621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile | 5456 | Open in IMG/M |
| Ga0099398_104432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2478 | Open in IMG/M |
| Ga0099398_105138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2003 | Open in IMG/M |
| Ga0099398_105389 | Not Available | 1866 | Open in IMG/M |
| Ga0099398_106640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1361 | Open in IMG/M |
| Ga0099398_110020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 770 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0099398_100135 | Ga0099398_1001353 | F089054 | MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSEHIRLQIREILQIPLSDITIIDIISLP* |
| Ga0099398_101558 | Ga0099398_1015584 | F042936 | MGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQKGALTPPYLGKLYFRSRLRGKG* |
| Ga0099398_101615 | Ga0099398_1016151 | F067845 | MKHWKNLLVCLLAGVLALGVLTACSGLGSVNTGTDAEKAAELAQQLGVAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADSNMGYTGDLNKFLYWSGCYGVPEDVTVALLLDDSTAMTAQLYAPQADSAAAELLEDAAGHSELGAAFIDYNGTAYVVAVFR* |
| Ga0099398_102621 | Ga0099398_1026213 | F047126 | VYLKTKKMTNISQTQAGFKSKSLGILCGFQGFLTQNPAALVETDDIFDVSDTPHGFSGLNTLRAAGVPNPPPPFAQRFIACFCSQTAAASQSKSAYILSSLESPCILCSLLRHFHILSKKLQKTC* |
| Ga0099398_104432 | Ga0099398_1044324 | F026592 | RTVCQNRLRTASPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| Ga0099398_105138 | Ga0099398_1051383 | F047125 | MDVVLLLMVLGVMLSGFWAADALDHIRKEIICQEGKRRGWWS* |
| Ga0099398_105389 | Ga0099398_1053892 | F044554 | SASPCIFFHTQAYVLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLFLSFPFSFRANFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL* |
| Ga0099398_106640 | Ga0099398_1066403 | F026592 | LRTASPQGIAALAAQGGVATLTERSDETFSVVQFSSADRE* |
| Ga0099398_110020 | Ga0099398_1100201 | F026592 | LRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE* |
| ⦗Top⦘ |