| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014785 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121299 | Gp0151679 | Ga0134507 |
| Sample Name | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P788T2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Washington |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 113432307 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → environmental samples → Firmicutes bacterium CAG:41 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: University of Washington | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F059106 | Metagenome | 134 | N |
| F067845 | Metagenome | 125 | N |
| F068811 | Metagenome | 124 | N |
| F097493 | Metagenome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134507_1001547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → environmental samples → Firmicutes bacterium CAG:41 | 6905 | Open in IMG/M |
| Ga0134507_1005792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2446 | Open in IMG/M |
| Ga0134507_1006410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 2284 | Open in IMG/M |
| Ga0134507_1024244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 857 | Open in IMG/M |
| Ga0134507_1038329 | Not Available | 594 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134507_1001547 | Ga0134507_10015477 | F097493 | MYKFYSKNGTAQFYERGVEIDGTVYGIRTDSDILRIKRSVLNSKFAESEEDFDMNVEIAKIQHTDITFEQPTAEQLSQIQAKKFDSMSDMKQHVQSVMSGDETMSQDEINAMLMLQIAELKAGVDGE* |
| Ga0134507_1005792 | Ga0134507_10057921 | F059106 | KIRVILLQKFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV* |
| Ga0134507_1006410 | Ga0134507_10064103 | F067845 | MKHWKNLLVCLLAGVLALGVLTACSGLGSVNTGTDAEKAAELARQLGVAYAPELDSTAKAVAEWFVQEPDSLRVSGLDLVYPVALDADSNMSHTDDLNKFLYWSGCDGVPDDVTVALPLDSTAMTAWLYAPQADSAAAELLKDAAGHSEMGAAFIDYNGTAYVVAVFR* |
| Ga0134507_1024244 | Ga0134507_10242442 | F068811 | MDQDGSEHNICSNREGLCPGKEPHGASGWKKIFQHGKEPLRNKDSVSQYCNKKVAVSLILNENVSETLCIFSIDKTNGCRI* |
| Ga0134507_1038329 | Ga0134507_10383292 | F026592 | TQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |