


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008060 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053107 | Ga0114177 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 159227541 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 96209904 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F042095 | Metagenome | 159 | N |
| F073656 | Metagenome | 120 | N |
| F074899 | Metagenome / Metatranscriptome | 119 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0114177_100037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae | 157275 | Open in IMG/M |
| Ga0114177_100172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 77941 | Open in IMG/M |
| Ga0114177_101430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 12486 | Open in IMG/M |
| Ga0114177_106899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1452 | Open in IMG/M |
| Ga0114177_107525 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0114177_100037 | Ga0114177_100037164 | F042095 | MAKTLYKYEASSNKFVWFTTWDRALRNYYTDDYNYVPDPVVDNSYNTFVEFRSRKPGMANVDWGDGIKEQFPMTKVQGENNYRIIFRSLAIQHRKNPNTTWWFRKEDGSQYVPVDNHAYADGRRDVQRAVSIDFTCDIYYANIQVCKMTSFPIVDMPGLEFLVVSHTLYVNDGIPVDRLSRSKKLIYIGLSNMGQRMTVIPEAIISKTEVYYLNMFNMLDLRDIESSGIRNIKNMKNLETLDLSSCYLDRYIKEFNDLPKLKTLNITPAPSDMWNYFDINTLPFFEVDKINPNITDFYFLSDWMSGERRTGWNDDNMSGRGLEHLTGFIAANSNSLRMDKLPDYIYEMRAITWFNVNASTHSQKRSDDFVNSFYDLVVGWDQITMTSVAKDGKRNQFYSLSVSMYDAIYPTENQRPSGTEQAPEGFVKGSSNGSPATPMEKIYVLKNNYAQRWTIKPE* |
| Ga0114177_100172 | Ga0114177_10017216 | F073656 | MTMEQEQDQEQTQAALYVAVDDGNKIVAMERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHSYLLDPSTATEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRCCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFADPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGTEFHLKRH* |
| Ga0114177_101430 | Ga0114177_10143017 | F074899 | MSGRKQWNKQAATSSFLDKKTPQSLIQQGLEGSTVVGKDEVGSSNLPSSSKMC* |
| Ga0114177_106899 | Ga0114177_1068992 | F074899 | DPHGKMSGRKQWNKQAATSSFLDKKPLESLILQGMEGSTTLGKDEVGSSNLPSSSK* |
| Ga0114177_107525 | Ga0114177_1075251 | F026592 | LRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
| ⦗Top⦘ |