


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007298 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052697 | Ga0104838 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 160603188 reassembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 150744950 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 7 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. ATCC BAA-442 | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F051936 | Metagenome | 143 | N |
| F076064 | Metagenome | 118 | N |
| F081453 | Metagenome | 114 | N |
| F089054 | Metagenome | 109 | N |
| F101356 | Metagenome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0104838_100121 | Not Available | 84228 | Open in IMG/M |
| Ga0104838_100290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 48386 | Open in IMG/M |
| Ga0104838_102845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. ATCC BAA-442 | 7497 | Open in IMG/M |
| Ga0104838_102862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 7462 | Open in IMG/M |
| Ga0104838_107031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3236 | Open in IMG/M |
| Ga0104838_133619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 702 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0104838_100121 | Ga0104838_10012182 | F089054 | MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSEHIRLQIREILQIPLRDITIIDIISLP* |
| Ga0104838_100290 | Ga0104838_10029027 | F081453 | MFPFFLLAGENIIEKHISANPVCGTNIKAPEPAVKGAPGRKFV* |
| Ga0104838_102845 | Ga0104838_1028459 | F032286 | MVKWVCQIVTHIRHRALVFDTRLFAGNTADDTLVTGSPFRFCRLVCLCVKRRNIKPDSKRRSLPDSALFHADNRTEQKTILPFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAL |
| Ga0104838_102862 | Ga0104838_1028627 | F051936 | VLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK* |
| Ga0104838_104489 | Ga0104838_1044891 | F101356 | RFTDVGELIPVVTPEKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFYVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDKSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ* |
| Ga0104838_107031 | Ga0104838_1070311 | F026592 | NSLRTASPQGIAALAAQGGVATLTERSDATFSVMQLFSADRE* |
| Ga0104838_133619 | Ga0104838_1336192 | F076064 | EASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY* |
| ⦗Top⦘ |