


| Basic Information | |
|---|---|
| Family ID | F005599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 395 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSER |
| Number of Associated Samples | 347 |
| Number of Associated Scaffolds | 395 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.68 % |
| % of genes near scaffold ends (potentially truncated) | 80.76 % |
| % of genes from short scaffolds (< 2000 bps) | 89.37 % |
| Associated GOLD sequencing projects | 339 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.481 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.114 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.266 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 395 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 17.47 |
| PF08388 | GIIM | 15.44 |
| PF02371 | Transposase_20 | 2.78 |
| PF01548 | DEDD_Tnp_IS110 | 0.76 |
| PF04392 | ABC_sub_bind | 0.51 |
| PF13701 | DDE_Tnp_1_4 | 0.51 |
| PF07690 | MFS_1 | 0.51 |
| PF13408 | Zn_ribbon_recom | 0.25 |
| PF00497 | SBP_bac_3 | 0.25 |
| PF02926 | THUMP | 0.25 |
| PF00196 | GerE | 0.25 |
| PF00795 | CN_hydrolase | 0.25 |
| PF13458 | Peripla_BP_6 | 0.25 |
| PF07287 | AtuA | 0.25 |
| PF00534 | Glycos_transf_1 | 0.25 |
| PF13276 | HTH_21 | 0.25 |
| PF09278 | MerR-DNA-bind | 0.25 |
| PF00892 | EamA | 0.25 |
| PF03050 | DDE_Tnp_IS66 | 0.25 |
| PF03781 | FGE-sulfatase | 0.25 |
| PF01593 | Amino_oxidase | 0.25 |
| PF00535 | Glycos_transf_2 | 0.25 |
| PF00665 | rve | 0.25 |
| PF03150 | CCP_MauG | 0.25 |
| PF01435 | Peptidase_M48 | 0.25 |
| PF00067 | p450 | 0.25 |
| PF00144 | Beta-lactamase | 0.25 |
| PF01695 | IstB_IS21 | 0.25 |
| PF02493 | MORN | 0.25 |
| PF13546 | DDE_5 | 0.25 |
| PF03265 | DNase_II | 0.25 |
| PF00990 | GGDEF | 0.25 |
| PF07702 | UTRA | 0.25 |
| PF13358 | DDE_3 | 0.25 |
| PF07883 | Cupin_2 | 0.25 |
| PF08240 | ADH_N | 0.25 |
| PF00815 | Histidinol_dh | 0.25 |
| PF04366 | Ysc84 | 0.25 |
| PF02639 | DUF188 | 0.25 |
| PF13437 | HlyD_3 | 0.25 |
| PF02873 | MurB_C | 0.25 |
| PF01527 | HTH_Tnp_1 | 0.25 |
| PF01797 | Y1_Tnp | 0.25 |
| PF12833 | HTH_18 | 0.25 |
| PF07519 | Tannase | 0.25 |
| PF00561 | Abhydrolase_1 | 0.25 |
| COG ID | Name | Functional Category | % Frequency in 395 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.54 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.51 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.25 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.25 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.25 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.25 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.25 |
| COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 0.25 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.25 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.25 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.25 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.25 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.25 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.25 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.25 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.25 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.25 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.25 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.25 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.25 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.25 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 0.25 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.48 % |
| Unclassified | root | N/A | 1.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000041|ARcpr5oldR_c023592 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1008930 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1056717 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10020838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 1799 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1048630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1087068 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300000667|JGI12495J11915_100714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 526 | Open in IMG/M |
| 3300000672|JGI11858J11886_100422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 730 | Open in IMG/M |
| 3300000681|JGI12370J11904_100496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 745 | Open in IMG/M |
| 3300000732|JGI12023J11887_1000777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1760 | Open in IMG/M |
| 3300000732|JGI12023J11887_1006382 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300000732|JGI12023J11887_1010014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 560 | Open in IMG/M |
| 3300000733|JGI12408J11912_1015274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 566 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10023219 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1047882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 668 | Open in IMG/M |
| 3300000955|JGI1027J12803_100277420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 737 | Open in IMG/M |
| 3300000956|JGI10216J12902_103965835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1702 | Open in IMG/M |
| 3300001143|JGI12687J13287_101486 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300001163|JGI12705J13279_100534 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300001205|C688J13580_1000422 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300001686|C688J18823_10544381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 742 | Open in IMG/M |
| 3300001867|JGI12627J18819_10047897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1785 | Open in IMG/M |
| 3300001867|JGI12627J18819_10140937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 985 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101289346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 621 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101491878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 571 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101584977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 552 | Open in IMG/M |
| 3300002907|JGI25613J43889_10179308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 562 | Open in IMG/M |
| 3300002909|JGI25388J43891_1071106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 532 | Open in IMG/M |
| 3300002912|JGI25386J43895_10109031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 694 | Open in IMG/M |
| 3300002917|JGI25616J43925_10192150 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300003163|Ga0006759J45824_1023375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 614 | Open in IMG/M |
| 3300003973|Ga0063521_1002681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii | 4304 | Open in IMG/M |
| 3300003997|Ga0055466_10073985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 888 | Open in IMG/M |
| 3300004001|Ga0055450_10078009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1166 | Open in IMG/M |
| 3300004113|Ga0065183_10431673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 639 | Open in IMG/M |
| 3300004114|Ga0062593_100425293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
| 3300004152|Ga0062386_101841617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300004268|Ga0066398_10061750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 787 | Open in IMG/M |
| 3300004798|Ga0058859_11397825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 546 | Open in IMG/M |
| 3300005161|Ga0066807_1037577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300005177|Ga0066690_10437299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 886 | Open in IMG/M |
| 3300005180|Ga0066685_10415301 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005329|Ga0070683_100214054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1831 | Open in IMG/M |
| 3300005332|Ga0066388_102795983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 891 | Open in IMG/M |
| 3300005332|Ga0066388_103810340 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005332|Ga0066388_107121164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 562 | Open in IMG/M |
| 3300005347|Ga0070668_101940196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 543 | Open in IMG/M |
| 3300005353|Ga0070669_101480637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 590 | Open in IMG/M |
| 3300005363|Ga0008090_10077634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1874 | Open in IMG/M |
| 3300005363|Ga0008090_10158238 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300005437|Ga0070710_10208157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1238 | Open in IMG/M |
| 3300005441|Ga0070700_101867001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300005445|Ga0070708_100174715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2007 | Open in IMG/M |
| 3300005447|Ga0066689_10787507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 591 | Open in IMG/M |
| 3300005505|Ga0068898_10026823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300005518|Ga0070699_102070752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 520 | Open in IMG/M |
| 3300005562|Ga0058697_10238606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 841 | Open in IMG/M |
| 3300005578|Ga0068854_101210443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 677 | Open in IMG/M |
| 3300005587|Ga0066654_10538393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
| 3300005598|Ga0066706_10661402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 829 | Open in IMG/M |
| 3300005598|Ga0066706_10688967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 812 | Open in IMG/M |
| 3300005602|Ga0070762_11108253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300005616|Ga0068852_101736173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300005718|Ga0068866_10205375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1179 | Open in IMG/M |
| 3300005719|Ga0068861_101583937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
| 3300005764|Ga0066903_100485533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2085 | Open in IMG/M |
| 3300005764|Ga0066903_100555925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1970 | Open in IMG/M |
| 3300005764|Ga0066903_101300293 | Not Available | 1358 | Open in IMG/M |
| 3300005764|Ga0066903_103066942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 904 | Open in IMG/M |
| 3300005764|Ga0066903_103230802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 881 | Open in IMG/M |
| 3300005764|Ga0066903_107186018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 576 | Open in IMG/M |
| 3300005921|Ga0070766_10091690 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300005921|Ga0070766_10115757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1605 | Open in IMG/M |
| 3300005937|Ga0081455_10148469 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300005947|Ga0066794_10103284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 852 | Open in IMG/M |
| 3300005980|Ga0066798_10093414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 884 | Open in IMG/M |
| 3300005995|Ga0066790_10369394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300005996|Ga0076930_102933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5694 | Open in IMG/M |
| 3300006016|Ga0079974_110140 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300006047|Ga0075024_100783991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300006050|Ga0075028_100070906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1722 | Open in IMG/M |
| 3300006052|Ga0075029_100856903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300006059|Ga0075017_101125852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300006059|Ga0075017_101193920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 596 | Open in IMG/M |
| 3300006086|Ga0075019_10297316 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300006172|Ga0075018_10579032 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006173|Ga0070716_100225590 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300006175|Ga0070712_100127374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1925 | Open in IMG/M |
| 3300006574|Ga0074056_11797226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1090 | Open in IMG/M |
| 3300006578|Ga0074059_12152214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1479 | Open in IMG/M |
| 3300006580|Ga0074049_12841122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1244 | Open in IMG/M |
| 3300006603|Ga0074064_10011661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 557 | Open in IMG/M |
| 3300006642|Ga0075521_10098694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1337 | Open in IMG/M |
| 3300006642|Ga0075521_10257288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 835 | Open in IMG/M |
| 3300006755|Ga0079222_12032971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
| 3300006804|Ga0079221_11110527 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006806|Ga0079220_11797813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
| 3300006844|Ga0075428_100443486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1391 | Open in IMG/M |
| 3300006845|Ga0075421_100915597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 999 | Open in IMG/M |
| 3300006845|Ga0075421_102120704 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006864|Ga0066797_1104559 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300006904|Ga0075424_100125350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2714 | Open in IMG/M |
| 3300006914|Ga0075436_101390403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 532 | Open in IMG/M |
| 3300006938|Ga0081245_1007581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 505 | Open in IMG/M |
| 3300006954|Ga0079219_10261414 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300007004|Ga0079218_10697920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 951 | Open in IMG/M |
| 3300007076|Ga0075435_100619406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 939 | Open in IMG/M |
| 3300007258|Ga0099793_10468010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 624 | Open in IMG/M |
| 3300007265|Ga0099794_10435226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sGM-13 | 687 | Open in IMG/M |
| 3300007265|Ga0099794_10590317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 588 | Open in IMG/M |
| 3300007788|Ga0099795_10025872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1972 | Open in IMG/M |
| 3300007799|Ga0105049_10195641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Gluconacetobacter | 1741 | Open in IMG/M |
| 3300007822|Ga0104325_122093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1745 | Open in IMG/M |
| 3300007964|Ga0100400_1103912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
| 3300008020|Ga0100398_1259650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 765 | Open in IMG/M |
| 3300008085|Ga0100378_1468675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300009004|Ga0100377_1042241 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300009011|Ga0105251_10638226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300009038|Ga0099829_10027489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4009 | Open in IMG/M |
| 3300009038|Ga0099829_10362267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1195 | Open in IMG/M |
| 3300009071|Ga0115566_10259932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1036 | Open in IMG/M |
| 3300009093|Ga0105240_10653361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1152 | Open in IMG/M |
| 3300009094|Ga0111539_11217402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 874 | Open in IMG/M |
| 3300009143|Ga0099792_10377982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 862 | Open in IMG/M |
| 3300009146|Ga0105091_10488373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300009156|Ga0111538_10246266 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300009162|Ga0075423_10179928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2219 | Open in IMG/M |
| 3300009488|Ga0114925_11113758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 577 | Open in IMG/M |
| 3300009520|Ga0116214_1064088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1337 | Open in IMG/M |
| 3300009547|Ga0116136_1191883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
| 3300009553|Ga0105249_12136567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 633 | Open in IMG/M |
| 3300009610|Ga0105340_1306972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 693 | Open in IMG/M |
| 3300009665|Ga0116135_1136259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 909 | Open in IMG/M |
| 3300009686|Ga0123338_10035339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3150 | Open in IMG/M |
| 3300009787|Ga0116226_11479503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 631 | Open in IMG/M |
| 3300009823|Ga0105078_1013957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 886 | Open in IMG/M |
| 3300010038|Ga0126315_10264517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1053 | Open in IMG/M |
| 3300010038|Ga0126315_10811497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300010043|Ga0126380_10273469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 1185 | Open in IMG/M |
| 3300010046|Ga0126384_10095730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2177 | Open in IMG/M |
| 3300010047|Ga0126382_10117192 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300010125|Ga0127443_1067320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 532 | Open in IMG/M |
| 3300010152|Ga0126318_10930352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300010152|Ga0126318_11052449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 553 | Open in IMG/M |
| 3300010159|Ga0099796_10023673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1920 | Open in IMG/M |
| 3300010321|Ga0134067_10203205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 729 | Open in IMG/M |
| 3300010339|Ga0074046_10639799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 627 | Open in IMG/M |
| 3300010343|Ga0074044_10053386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2768 | Open in IMG/M |
| 3300010362|Ga0126377_10189489 | Not Available | 1963 | Open in IMG/M |
| 3300010362|Ga0126377_10632756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1117 | Open in IMG/M |
| 3300010362|Ga0126377_10890749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 952 | Open in IMG/M |
| 3300010366|Ga0126379_11888688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 701 | Open in IMG/M |
| 3300010376|Ga0126381_100664994 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300010869|Ga0126359_1562220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2354 | Open in IMG/M |
| 3300010880|Ga0126350_10824648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1552 | Open in IMG/M |
| 3300010885|Ga0133913_10723350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2602 | Open in IMG/M |
| 3300011120|Ga0150983_10290838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1095 | Open in IMG/M |
| 3300011249|Ga0137489_1022902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 695 | Open in IMG/M |
| 3300011270|Ga0137391_10792991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 781 | Open in IMG/M |
| 3300011431|Ga0137438_1227662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300012002|Ga0153774_1102889 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300012021|Ga0120192_10000203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4765 | Open in IMG/M |
| 3300012096|Ga0137389_10770926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 826 | Open in IMG/M |
| 3300012170|Ga0136598_1012344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2185 | Open in IMG/M |
| 3300012173|Ga0137327_1144411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 520 | Open in IMG/M |
| 3300012189|Ga0137388_10915514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 811 | Open in IMG/M |
| 3300012199|Ga0137383_10052130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2926 | Open in IMG/M |
| 3300012201|Ga0137365_10130080 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300012202|Ga0137363_11005174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708 | Open in IMG/M |
| 3300012203|Ga0137399_10626001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 905 | Open in IMG/M |
| 3300012203|Ga0137399_10980562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sGM-13 | 712 | Open in IMG/M |
| 3300012204|Ga0137374_10771984 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012208|Ga0137376_10529316 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012208|Ga0137376_11314370 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012209|Ga0137379_10676553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300012209|Ga0137379_10715909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 906 | Open in IMG/M |
| 3300012210|Ga0137378_10402601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1270 | Open in IMG/M |
| 3300012210|Ga0137378_10489399 | Not Available | 1136 | Open in IMG/M |
| 3300012212|Ga0150985_107954559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1053 | Open in IMG/M |
| 3300012212|Ga0150985_113643996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300012212|Ga0150985_119235900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 533 | Open in IMG/M |
| 3300012354|Ga0137366_10183162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1570 | Open in IMG/M |
| 3300012354|Ga0137366_10618163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 776 | Open in IMG/M |
| 3300012357|Ga0137384_11338085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300012360|Ga0137375_11006608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300012361|Ga0137360_11343459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300012362|Ga0137361_10102589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2491 | Open in IMG/M |
| 3300012362|Ga0137361_10348122 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300012381|Ga0134026_1034863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 534 | Open in IMG/M |
| 3300012407|Ga0134050_1369440 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012469|Ga0150984_109004247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2210 | Open in IMG/M |
| 3300012469|Ga0150984_117651022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 939 | Open in IMG/M |
| 3300012683|Ga0137398_10181503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300012894|Ga0160427_10246506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300012897|Ga0157285_10315417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 537 | Open in IMG/M |
| 3300012922|Ga0137394_10255332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1499 | Open in IMG/M |
| 3300012927|Ga0137416_10165075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1748 | Open in IMG/M |
| 3300012927|Ga0137416_10232585 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300012948|Ga0126375_11207770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 630 | Open in IMG/M |
| 3300012951|Ga0164300_10135453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1134 | Open in IMG/M |
| 3300012971|Ga0126369_12662571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 584 | Open in IMG/M |
| 3300012985|Ga0164308_10022962 | All Organisms → cellular organisms → Bacteria | 3673 | Open in IMG/M |
| 3300012986|Ga0164304_10168549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1399 | Open in IMG/M |
| 3300012987|Ga0164307_10918575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 706 | Open in IMG/M |
| 3300013094|Ga0164297_10000358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 57517 | Open in IMG/M |
| 3300014160|Ga0181517_10205634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1074 | Open in IMG/M |
| 3300014268|Ga0075309_1004755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2653 | Open in IMG/M |
| 3300014321|Ga0075353_1130957 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014326|Ga0157380_10578923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1107 | Open in IMG/M |
| 3300015024|Ga0167669_1005507 | All Organisms → cellular organisms → Bacteria | 8746 | Open in IMG/M |
| 3300015202|Ga0167663_1010026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 5076 | Open in IMG/M |
| 3300015202|Ga0167663_1106008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
| 3300015373|Ga0132257_104443091 | Not Available | 510 | Open in IMG/M |
| 3300016294|Ga0182041_10180116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1663 | Open in IMG/M |
| 3300016294|Ga0182041_12023356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 536 | Open in IMG/M |
| 3300016319|Ga0182033_10155252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1772 | Open in IMG/M |
| 3300016341|Ga0182035_10126354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1922 | Open in IMG/M |
| 3300016404|Ga0182037_10172953 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300016698|Ga0181503_1023123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300016728|Ga0181500_1314684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 911 | Open in IMG/M |
| 3300017933|Ga0187801_10394751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 574 | Open in IMG/M |
| 3300017965|Ga0190266_10482100 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300017970|Ga0187783_11223961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300017973|Ga0187780_10389371 | Not Available | 988 | Open in IMG/M |
| 3300017994|Ga0187822_10344384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 537 | Open in IMG/M |
| 3300017999|Ga0187767_10018990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1464 | Open in IMG/M |
| 3300018028|Ga0184608_10210553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 852 | Open in IMG/M |
| 3300018032|Ga0187788_10242378 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300018044|Ga0187890_10331855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 853 | Open in IMG/M |
| 3300018046|Ga0187851_10861630 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018053|Ga0184626_10277591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 699 | Open in IMG/M |
| 3300018062|Ga0187784_10834336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 735 | Open in IMG/M |
| 3300018082|Ga0184639_10085593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1659 | Open in IMG/M |
| 3300018085|Ga0187772_10241342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1225 | Open in IMG/M |
| 3300018422|Ga0190265_10197107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2021 | Open in IMG/M |
| 3300018465|Ga0190269_10108377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1373 | Open in IMG/M |
| 3300018466|Ga0190268_11081692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 650 | Open in IMG/M |
| 3300018481|Ga0190271_13732646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
| 3300019156|Ga0184576_119927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 839 | Open in IMG/M |
| 3300019163|Ga0184581_120245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1244 | Open in IMG/M |
| 3300019182|Ga0184598_103592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300019188|Ga0184599_149153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 849 | Open in IMG/M |
| 3300019230|Ga0181501_1140559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1414 | Open in IMG/M |
| 3300019257|Ga0180115_1190384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 825 | Open in IMG/M |
| 3300019257|Ga0180115_1366896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1976 | Open in IMG/M |
| 3300019263|Ga0184647_1486761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 583 | Open in IMG/M |
| 3300019268|Ga0181514_1462782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1883 | Open in IMG/M |
| 3300019269|Ga0184644_1499512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 640 | Open in IMG/M |
| 3300019270|Ga0181512_1263883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300019866|Ga0193756_1008787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1301 | Open in IMG/M |
| 3300019882|Ga0193713_1026844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1697 | Open in IMG/M |
| 3300020000|Ga0193692_1038230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1108 | Open in IMG/M |
| 3300020022|Ga0193733_1029780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1541 | Open in IMG/M |
| 3300020418|Ga0211557_10030266 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300020817|Ga0214258_11383953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 631 | Open in IMG/M |
| 3300021078|Ga0210381_10139374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 816 | Open in IMG/M |
| 3300021082|Ga0210380_10087984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1366 | Open in IMG/M |
| 3300021086|Ga0179596_10044699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1803 | Open in IMG/M |
| 3300021178|Ga0210408_10303679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1272 | Open in IMG/M |
| 3300021405|Ga0210387_10167946 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300021478|Ga0210402_11660884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300021560|Ga0126371_10295405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1746 | Open in IMG/M |
| 3300022413|Ga0224508_10394454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 873 | Open in IMG/M |
| 3300022531|Ga0242660_1006480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1850 | Open in IMG/M |
| 3300022534|Ga0224452_1057487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1161 | Open in IMG/M |
| 3300022561|Ga0212090_10055957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4156 | Open in IMG/M |
| 3300022732|Ga0224569_103935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300022756|Ga0222622_10060282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2186 | Open in IMG/M |
| 3300023030|Ga0224561_1007672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
| 3300024045|Ga0233345_1036060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300025568|Ga0210095_1126198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 615 | Open in IMG/M |
| 3300025854|Ga0209176_10006689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2165 | Open in IMG/M |
| 3300025898|Ga0207692_11126551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 520 | Open in IMG/M |
| 3300025915|Ga0207693_10159138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1777 | Open in IMG/M |
| 3300025918|Ga0207662_10252183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1159 | Open in IMG/M |
| 3300025920|Ga0207649_11245576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 588 | Open in IMG/M |
| 3300026335|Ga0209804_1344702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300026371|Ga0257179_1001706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1650 | Open in IMG/M |
| 3300026371|Ga0257179_1002413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1509 | Open in IMG/M |
| 3300026482|Ga0257172_1048737 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300026489|Ga0257160_1002816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1947 | Open in IMG/M |
| 3300026490|Ga0257153_1016873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1484 | Open in IMG/M |
| 3300026496|Ga0257157_1003799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2249 | Open in IMG/M |
| 3300026507|Ga0257165_1009013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1528 | Open in IMG/M |
| 3300026538|Ga0209056_10361179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 942 | Open in IMG/M |
| 3300026810|Ga0207801_111678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 540 | Open in IMG/M |
| 3300026819|Ga0207765_108822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 843 | Open in IMG/M |
| 3300026855|Ga0208404_1001483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 811 | Open in IMG/M |
| 3300026908|Ga0207787_1008837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1049 | Open in IMG/M |
| 3300026959|Ga0207852_1005307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 1491 | Open in IMG/M |
| 3300027010|Ga0207839_1001798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2984 | Open in IMG/M |
| 3300027058|Ga0209111_1017376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 836 | Open in IMG/M |
| 3300027297|Ga0208241_1008526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1405 | Open in IMG/M |
| 3300027480|Ga0208993_1027839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii → Sinorhizobium fredii USDA 257 | 1001 | Open in IMG/M |
| 3300027560|Ga0207981_1029030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1003 | Open in IMG/M |
| 3300027629|Ga0209422_1058545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 918 | Open in IMG/M |
| 3300027635|Ga0209625_1018873 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300027645|Ga0209117_1171874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300027654|Ga0209799_1011304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1916 | Open in IMG/M |
| 3300027654|Ga0209799_1012349 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300027738|Ga0208989_10003074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum | 5498 | Open in IMG/M |
| 3300027768|Ga0209772_10049519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1249 | Open in IMG/M |
| 3300027790|Ga0209273_10208659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300027795|Ga0209139_10011478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3280 | Open in IMG/M |
| 3300027795|Ga0209139_10283144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300027808|Ga0209354_10175622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
| 3300027834|Ga0209344_10008874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7699 | Open in IMG/M |
| 3300027851|Ga0209066_10510868 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027853|Ga0209274_10063125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1779 | Open in IMG/M |
| 3300027862|Ga0209701_10056948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LTSP849 | 2495 | Open in IMG/M |
| 3300027866|Ga0209813_10083344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1061 | Open in IMG/M |
| 3300027902|Ga0209048_10324748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1072 | Open in IMG/M |
| 3300027910|Ga0209583_10032993 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300027910|Ga0209583_10356822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 682 | Open in IMG/M |
| 3300027986|Ga0209168_10083171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1667 | Open in IMG/M |
| 3300028012|Ga0265346_103388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
| 3300028565|Ga0302145_10317526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300028599|Ga0265309_10210290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1221 | Open in IMG/M |
| 3300028762|Ga0302202_10051638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2657 | Open in IMG/M |
| 3300028762|Ga0302202_10139730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1316 | Open in IMG/M |
| 3300028787|Ga0307323_10032720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1808 | Open in IMG/M |
| 3300028819|Ga0307296_10103522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1527 | Open in IMG/M |
| 3300028875|Ga0307289_10098666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1191 | Open in IMG/M |
| 3300028906|Ga0308309_11099816 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300028906|Ga0308309_11507601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 574 | Open in IMG/M |
| 3300029894|Ga0247028_1023903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1973 | Open in IMG/M |
| 3300029915|Ga0311358_10201030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1810 | Open in IMG/M |
| 3300029956|Ga0302150_10173790 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300030501|Ga0268244_10639135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 582 | Open in IMG/M |
| 3300030707|Ga0310038_10442144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 558 | Open in IMG/M |
| 3300030763|Ga0265763_1010657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300030844|Ga0075377_11774133 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300030884|Ga0265758_101953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
| 3300030885|Ga0265743_104205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
| 3300030963|Ga0265768_103420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
| 3300030969|Ga0075394_12097458 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300030975|Ga0099845_1004608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 616 | Open in IMG/M |
| 3300030993|Ga0308190_1069652 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031016|Ga0265732_101017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300031082|Ga0308192_1021403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 843 | Open in IMG/M |
| 3300031090|Ga0265760_10021072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1884 | Open in IMG/M |
| 3300031092|Ga0308204_10115829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 757 | Open in IMG/M |
| 3300031092|Ga0308204_10180718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 646 | Open in IMG/M |
| 3300031093|Ga0308197_10093532 | Not Available | 876 | Open in IMG/M |
| 3300031231|Ga0170824_122469864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1196 | Open in IMG/M |
| 3300031354|Ga0307446_1026053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1777 | Open in IMG/M |
| 3300031421|Ga0308194_10008533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1875 | Open in IMG/M |
| 3300031446|Ga0170820_15172027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300031456|Ga0307513_10700839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 718 | Open in IMG/M |
| 3300031520|Ga0272428_1036756 | All Organisms → cellular organisms → Bacteria | 4299 | Open in IMG/M |
| 3300031561|Ga0318528_10061803 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300031640|Ga0318555_10735366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 533 | Open in IMG/M |
| 3300031668|Ga0318542_10471105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 652 | Open in IMG/M |
| 3300031677|Ga0307480_1020530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300031679|Ga0318561_10401542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 753 | Open in IMG/M |
| 3300031681|Ga0318572_10091090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1707 | Open in IMG/M |
| 3300031682|Ga0318560_10710264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 543 | Open in IMG/M |
| 3300031708|Ga0310686_114997811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 622 | Open in IMG/M |
| 3300031720|Ga0307469_11646933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 617 | Open in IMG/M |
| 3300031744|Ga0306918_10058147 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300031744|Ga0306918_10579417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300031754|Ga0307475_11237709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300031763|Ga0318537_10045547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1584 | Open in IMG/M |
| 3300031778|Ga0318498_10052926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1804 | Open in IMG/M |
| 3300031781|Ga0318547_10671998 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031793|Ga0318548_10148394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1142 | Open in IMG/M |
| 3300031795|Ga0318557_10300050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 737 | Open in IMG/M |
| 3300031797|Ga0318550_10055393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1792 | Open in IMG/M |
| 3300031798|Ga0318523_10607609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 538 | Open in IMG/M |
| 3300031820|Ga0307473_11059203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 595 | Open in IMG/M |
| 3300031846|Ga0318512_10052668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1821 | Open in IMG/M |
| 3300031879|Ga0306919_11134249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 595 | Open in IMG/M |
| 3300031890|Ga0306925_11615877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300031893|Ga0318536_10526680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300031910|Ga0306923_10644715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300031941|Ga0310912_10203830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1513 | Open in IMG/M |
| 3300031942|Ga0310916_10921462 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300031946|Ga0310910_10198864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1555 | Open in IMG/M |
| 3300031946|Ga0310910_10807555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 738 | Open in IMG/M |
| 3300031981|Ga0318531_10079016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1431 | Open in IMG/M |
| 3300032043|Ga0318556_10456383 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300032075|Ga0310890_11863536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300032076|Ga0306924_12053618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 587 | Open in IMG/M |
| 3300032160|Ga0311301_10074334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7098 | Open in IMG/M |
| 3300032160|Ga0311301_11723435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 752 | Open in IMG/M |
| 3300032174|Ga0307470_11078860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 644 | Open in IMG/M |
| 3300032261|Ga0306920_100984623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1229 | Open in IMG/M |
| 3300032261|Ga0306920_101690544 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032431|Ga0335395_10714839 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032954|Ga0335083_10636896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 874 | Open in IMG/M |
| 3300033979|Ga0334978_0002636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10208 | Open in IMG/M |
| 3300034025|Ga0334940_096905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 802 | Open in IMG/M |
| 3300034141|Ga0334958_051612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 876 | Open in IMG/M |
| 3300034236|Ga0334938_076941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 647 | Open in IMG/M |
| 3300034354|Ga0364943_0004060 | All Organisms → cellular organisms → Bacteria | 4210 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.27% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.01% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.01% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.01% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.51% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.51% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.51% |
| Hypersaline Mat | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.25% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.25% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.25% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.25% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.25% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.25% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.25% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.25% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.25% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.25% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.25% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.25% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.25% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.25% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.25% |
| Saline Lake Microbial Mat | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Saline Lake Microbial Mat | 0.25% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.25% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.25% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.25% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.25% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.25% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.25% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 0.25% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.25% |
| Basal Ice | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Basal Ice | 0.25% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.25% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.25% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.25% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.25% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.25% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.25% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.25% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.25% |
| Ips Typographus Gut | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Ips Typographus Gut | 0.25% |
| Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 0.25% |
| Solar Cell Surface | Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface | 0.25% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000667 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 | Environmental | Open in IMG/M |
| 3300000672 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 | Environmental | Open in IMG/M |
| 3300000681 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 | Environmental | Open in IMG/M |
| 3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
| 3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001163 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Host-Associated | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005505 | Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300005996 | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Hot Lake Consortium UCC-RE (version 3) | Environmental | Open in IMG/M |
| 3300006016 | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Hot Lake Consortium UCC-R28 (version 3) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006938 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007964 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-24 | Environmental | Open in IMG/M |
| 3300008020 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 | Environmental | Open in IMG/M |
| 3300008085 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-02 | Environmental | Open in IMG/M |
| 3300009004 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011249 | Basal ice microbial communities from dark ice on Arctic glacier surface, Midre Lovenbreen, Svalbard, Norway (sample 23) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300012002 | Saline lake microbial mat microbial communities from Tebenquiche Lake, II Region de Antofagasta, Chile - Tebenquiche 201212 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012170 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #899 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012894 | Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - L | Engineered | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015024 | Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite) | Environmental | Open in IMG/M |
| 3300015202 | Arctic sediment microbial communities from supraglacial cryoconite, Storglaci?ren, Tarfala, Sweden (Sample st-12a, ablation zone cryoconite) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019156 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020817 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahit | Engineered | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024045 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-285 | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026855 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028012 | Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029894 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030501 | Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031016 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031354 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300034025 | Biocrust microbial communities from Mojave Desert, California, United States - 36SMC | Environmental | Open in IMG/M |
| 3300034141 | Biocrust microbial communities from Mojave Desert, California, United States - 54SNC | Environmental | Open in IMG/M |
| 3300034236 | Biocrust microbial communities from Mojave Desert, California, United States - 34SMC | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5oldR_0235921 | 3300000041 | Arabidopsis Rhizosphere | ASKVKVRMPTRLNNGEGRVNGEAIDARTRSIRRGSELGTLGW* |
| AP72_2010_repI_A01DRAFT_10089301 | 3300000579 | Forest Soil | MRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG* |
| AF_2010_repII_A01DRAFT_10567172 | 3300000580 | Forest Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDAHTCLIRRGSGHGTSERWFG* |
| AF_2010_repII_A1DRAFT_100208381 | 3300000597 | Forest Soil | VTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDAHTCLIRRGSGHGTSERWFG* |
| AP72_2010_repI_A10DRAFT_10486301 | 3300000651 | Forest Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG* |
| AF_2010_repII_A100DRAFT_10870681 | 3300000655 | Forest Soil | PTLLPFGEGRVSGEAIDARTRSIRRGSGHGTSERWFG* |
| JGI12495J11915_1007141 | 3300000667 | Tropical Forest Soil | LLPFGEGRVSGEAIDMGTRSIRRGSGLGTSEGWFG* |
| JGI11858J11886_1004222 | 3300000672 | Forest Soil | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGI12370J11904_1004962 | 3300000681 | Tropical Forest Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMGTRSIRRGSGLGTSEGWFG* |
| JGI12023J11887_10007771 | 3300000732 | Forest Soil | MPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGI12023J11887_10063821 | 3300000732 | Forest Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG* |
| JGI12023J11887_10100141 | 3300000732 | Forest Soil | MPTLLPFGEGRASGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGI12408J11912_10152742 | 3300000733 | Tropical Forest Soil | MMRMPTRRNLGEGRTDGEAIDARSHPIRRGNGHGTLEG* |
| AF_2010_repII_A001DRAFT_100232191 | 3300000793 | Forest Soil | RVKPEQASKVTMRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG* |
| AP72_2010_repI_A001DRAFT_10478822 | 3300000893 | Forest Soil | MRMPTLLPFGEGHVSGEAIDMSTRLIRRGSGRGTSERWFE* |
| JGI1027J12803_1002774202 | 3300000955 | Soil | PEQASKVKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG* |
| JGI10216J12902_1039658352 | 3300000956 | Soil | VKPEQASKVKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG* |
| JGI12687J13287_1014862 | 3300001143 | Forest Soil | AAMGGRAIQRAVTRVKSEQAPKVLMRMPTRHHFGEGRANGKVIDRRTRSIRRGNGHGTLER* |
| JGI12705J13279_1005341 | 3300001163 | Forest Soil | TKAAMGGRAIQRAVTRVKSEQAPKVLMRMPTRHHFGEGRANGKVIDRRTRSIRRGNGHGTLER* |
| C688J13580_10004221 | 3300001205 | Soil | IQRAVTRVKPEKASKVKMRMPTRLGNGEGRVSGEAIDTAPVSIRRGTGHGTLEG* |
| C688J18823_105443812 | 3300001686 | Soil | MPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSERWFG* |
| JGI12627J18819_100478973 | 3300001867 | Forest Soil | MGGRAIQRAVTRVKSEQAPKVLMRMPTRHHFGEGRANGKVIDRRTRSIRRGNGHGTLER* |
| JGI12627J18819_101409372 | 3300001867 | Forest Soil | VKPEQASKVEMRMPTRLQNGEGRTDGEEIDKRTRPIRRGIGHGTPEG* |
| JGIcombinedJ26739_1012893461 | 3300002245 | Forest Soil | KVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGIcombinedJ26739_1014918782 | 3300002245 | Forest Soil | TRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDACAHPIRRGSGHGTSEGWFG* |
| JGIcombinedJ26739_1015849771 | 3300002245 | Forest Soil | VTMRMPTLRPFGEGCTRGEAIDTRTHAIRRGSGHGTPEWWFE* |
| JGI25613J43889_101793081 | 3300002907 | Grasslands Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| JGI25388J43891_10711061 | 3300002909 | Grasslands Soil | KPEQASKVTMRMPTLLPFGEGSMSGEAIDMSTRSIRRGSRRGTLERWFG* |
| JGI25386J43895_101090312 | 3300002912 | Grasslands Soil | MXVKPEQASKVKMRMPTRQRYGEGRTDGEAIDARTHLVRRGNGHGTVER* |
| JGI25616J43925_101921502 | 3300002917 | Grasslands Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG* |
| Ga0006759J45824_10233751 | 3300003163 | Avena Fatua Rhizosphere | VKSEQASKVMMRMPTRLNNGEGRVNGEAIDICTHSIRRGSGHGTLEGWFG* |
| Ga0063521_10026815 | 3300003973 | Ips Typographus Gut | MRVKPEQASKVMMWMPTCLRFGEGRVNGEAIDMGTRSIHPGIGHGTLEG* |
| Ga0055466_100739852 | 3300003997 | Natural And Restored Wetlands | RAVTRVKPEQASKVMMRMPTRLNFGEGCTDGEAIDMSTRPIRRGNGHGTPER* |
| Ga0055450_100780092 | 3300004001 | Natural And Restored Wetlands | VKPEQASKVMMWMSTRLNNGEDSTSGEEIDERTRSIRRGNGHGTLEW* |
| Ga0065183_104316731 | 3300004113 | Pelagic Marine | PEQASKVTMRMPTLLPFGEGCMSGEGIDTRTRSIRRGSGHGTSEWWSG* |
| Ga0062593_1004252933 | 3300004114 | Soil | VKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG* |
| Ga0062386_1018416172 | 3300004152 | Bog Forest Soil | PEQASKVEMRMPTRLQNGEGSTEREAIDKRTRPIRRGSGHGTSER* |
| Ga0066398_100617501 | 3300004268 | Tropical Forest Soil | MRMPTLLPFGEGRVSGEVIDACTCSIRRGSGHGTWERWFG* |
| Ga0058859_113978252 | 3300004798 | Host-Associated | SKVEMRMPTRLQNGEGRTDGEAIDARIRPIRRGSGHGTPEG* |
| Ga0066807_10375771 | 3300005161 | Soil | VKPERASKVMMRMPTRLNFGEGRVNGEAIDRCTRSIRRGNGHGTSEG* |
| Ga0066690_104372992 | 3300005177 | Soil | VKMRTPTRLSNGEGRVNGEAIDARTRSVRRGMWHGTLEG* |
| Ga0066685_104153011 | 3300005180 | Soil | EQASKVTMRMPTLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSERWFG* |
| Ga0070683_1002140542 | 3300005329 | Corn Rhizosphere | AIRRAVTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDARIRPIRRGSGHGTPEG* |
| Ga0066388_1027959831 | 3300005332 | Tropical Forest Soil | ASKVTMRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTWERWFGQSGEARSVRG* |
| Ga0066388_1038103401 | 3300005332 | Tropical Forest Soil | VKPEQASKVTMRMPTLRPFGEGCMRGEAIDMRTHVIRRGRGHGTSERWFE* |
| Ga0066388_1071211641 | 3300005332 | Tropical Forest Soil | PEQASKVTMRMPTLLPFGEGCTSGEVIDTRTRSIRRGSGHGTSERWFG* |
| Ga0070668_1019401961 | 3300005347 | Switchgrass Rhizosphere | VKSEQASKGMMRMPTRLNNGEGRVNGEAIDICTHSIRRGSGHGTLEGWFGSSGEARLA* |
| Ga0070669_1014806372 | 3300005353 | Switchgrass Rhizosphere | VKPEQASKVEMRMPTRLQNGEGRTDGEAIDARIRPIRRGSGHGTPEG* |
| Ga0008090_100776342 | 3300005363 | Tropical Rainforest Soil | MRMPTLLPFGEGRVSGEVIDAHTCLIRRGSGHGTSERWFG* |
| Ga0008090_101582381 | 3300005363 | Tropical Rainforest Soil | KVTMRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG* |
| Ga0070710_102081573 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| Ga0070700_1018670011 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VKPEQASKVMMRMPTRLNFGEGRVNGEAIDRCTRSIRRGNGHGTSEG* |
| Ga0070708_1001747152 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PEQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG* |
| Ga0066689_107875071 | 3300005447 | Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0068898_100268231 | 3300005505 | Soil | VKSEQASKVMMRMPTRLHNGEGRVDGEAIDTCTHSIRRGSGHGTLEGWFG* |
| Ga0070699_1020707521 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KPEQASKVEMRTPTRLSNGEGRVNGEAIDVRTRSVRRGMWHGTLEG* |
| Ga0058697_102386062 | 3300005562 | Agave | VKSEQASKVMMRMPTRLNNGEGRVTGEAIDICTHSIRRGSGHGTLEGWFGSSGEARLA* |
| Ga0068854_1012104431 | 3300005578 | Corn Rhizosphere | MMRMPTRLNNGEGSMSGEEIDERTRLIRRGNGHGTLEW* |
| Ga0066654_105383932 | 3300005587 | Soil | MWVKPEQASKVKMRMPTRQRYGEGRTDGEAIDARTHLVRRGNGHGTVER* |
| Ga0066706_106614022 | 3300005598 | Soil | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFE* |
| Ga0066706_106889672 | 3300005598 | Soil | MRMPTLLPFGEGSMSGEAIDMSTRSIRRGSRRGTLERWFG* |
| Ga0070762_111082532 | 3300005602 | Soil | MRMPTLLPFGEGRASGEAIDTRTRSIRRGSGHGTSEMWFE* |
| Ga0068852_1017361731 | 3300005616 | Corn Rhizosphere | VKPEQASKVMMRMPTRLNNGEGRVNGEAIDICTHSIRRGSGHGTLEGWFG* |
| Ga0068866_102053752 | 3300005718 | Miscanthus Rhizosphere | VKSEQASKVMMRMPTRLHNGEGHVDGEEIDTCTHSIRRGSGHGTLEGWFG* |
| Ga0068861_1015839372 | 3300005719 | Switchgrass Rhizosphere | VKSEQASKGMMRMPTRLNNGEGRVNGEAIDICTHSIRRGSGHGTLEGWFGSSGEARLAGG |
| Ga0066903_1004855335 | 3300005764 | Tropical Forest Soil | RMPTFLPFGEGRVSGEAIDMCTRSIRRGSGRGTSERWLG* |
| Ga0066903_1005559251 | 3300005764 | Tropical Forest Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGRVNGEAIDMRTRLIRRGSGHGTSEG* |
| Ga0066903_1013002932 | 3300005764 | Tropical Forest Soil | VTMRMPTNRPNWEGCMSGEEIDTRTRSIRRGIGHGTSER* |
| Ga0066903_1030669422 | 3300005764 | Tropical Forest Soil | AQASKVTMRMPTLLPFGEGCTDREAIDARTCLIRRGSGHGTSEG* |
| Ga0066903_1032308021 | 3300005764 | Tropical Forest Soil | MRMPTFLPFGEGRVSGEAIDMCTRSIRRGSGRGTS |
| Ga0066903_1071860181 | 3300005764 | Tropical Forest Soil | MRMPTLLPFGEGRASGEVIDMRTRSIRRGSGLGTSEA* |
| Ga0070766_100916903 | 3300005921 | Soil | MRMPTLLPFGEGRVSGEAIDTRTRLIRRGSGHGTSE |
| Ga0070766_101157572 | 3300005921 | Soil | VKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSGR* |
| Ga0081455_101484693 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSEG* |
| Ga0066794_101032841 | 3300005947 | Soil | QASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTTERWFG* |
| Ga0066798_100934142 | 3300005980 | Soil | MRMPTRPKCGEGRVNGEVIDTSSRSIRRGNGHSTLEG* |
| Ga0066790_103693941 | 3300005995 | Soil | RAVTRVKPEQASKVSMRMPTLRPFGEGCMSGEEIDTSTRSIRRGSGHGTSERWFE* |
| Ga0076930_1029332 | 3300005996 | Hypersaline Mat | VKSEQASKVKVRMPTRLNNGEGRAGREAIDTRTCLIRRGSGHGTLER* |
| Ga0079974_1101401 | 3300006016 | Hypersaline Mat | VRMPTRLNNGEGRAGREAIDTRTCLIRRGSGHGTLER* |
| Ga0075024_1007839911 | 3300006047 | Watersheds | LESDNADAALLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0075028_1000709062 | 3300006050 | Watersheds | RVKPEQASKVTMRMPTLRPFGEGCMSGEAIDMSTRSIRRGSGHGTSERWFG* |
| Ga0075029_1008569033 | 3300006052 | Watersheds | AVTRVKPEQASKVKSRMPTCQRNGEGRVDGEAIDICIRLIRRGNGHGRSGR* |
| Ga0075017_1011258522 | 3300006059 | Watersheds | MRTPTWLQTGEGRVDREAIDTCTCRVRRGNGHGTSE* |
| Ga0075017_1011939201 | 3300006059 | Watersheds | MRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG* |
| Ga0075019_102973162 | 3300006086 | Watersheds | PTLRSFGEGRTCGEAIDTRTHAIRRGSGYGTSEG* |
| Ga0075018_105790321 | 3300006172 | Watersheds | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0070716_1002255902 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPTLLPFGEGCVSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0070712_1001273741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GRNVSEAEQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG* |
| Ga0074056_117972261 | 3300006574 | Soil | VKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRLIRRGSGHGTSGWWFG* |
| Ga0074059_121522142 | 3300006578 | Soil | QASKVTMRMPTLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSERWFG* |
| Ga0074049_128411221 | 3300006580 | Soil | AVTRVKPEQASKVMMRMPTRLNFGEGRVNGEAIDRCTRSIRRGNGHGTSEG* |
| Ga0074064_100116611 | 3300006603 | Soil | MRMPTLLLQGEGRVSGEAIDKSTRSIRRGSGHGTLERWFG* |
| Ga0075521_100986941 | 3300006642 | Arctic Peat Soil | QASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTTERWSE* |
| Ga0075521_102572881 | 3300006642 | Arctic Peat Soil | VKPEQASKVMMRMPTRLNNGEGRVDGEAIDTCTHSIRRGSGHGTLEGWFG* |
| Ga0079222_120329711 | 3300006755 | Agricultural Soil | VKSEQASKVMMRMPTRLNNGEGRVNGEAIDICTHSIRRGSGHGTLEGWFGSSGEARLA* |
| Ga0079221_111105271 | 3300006804 | Agricultural Soil | PEQASKVTMRMPTLLPFGEGRVSGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0079220_117978132 | 3300006806 | Agricultural Soil | MMRMPTRLNNGEGRVNGEAIDICTHSIRRGNGHGTLEGWFG |
| Ga0075428_1004434861 | 3300006844 | Populus Rhizosphere | RVKPEQASKVTMRMPTLLPFGEGRASGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0075421_1009155971 | 3300006845 | Populus Rhizosphere | MRMPTLLPFGEGCMSGEAIDTSTRSIRRGSGHGTSEWWFG* |
| Ga0075421_1021207042 | 3300006845 | Populus Rhizosphere | AIRRAVTRVKPEQASKVTMRMPTLLPFGEGRASGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0066797_11045591 | 3300006864 | Soil | MRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSE |
| Ga0075424_1001253501 | 3300006904 | Populus Rhizosphere | MQASKVTMRMPTLLPFGEGSNERGKLDTRTRSIRRGSGHGTS |
| Ga0075436_1013904032 | 3300006914 | Populus Rhizosphere | TRVKLEQASKVKVRMPTRLNNGEGRVNGEAIDARTRSIRRGSELGTLGW* |
| Ga0081245_10075811 | 3300006938 | Tropical Rainforest Soil | KVTMRMPTLLPFGEGCMSGEAIDTRTHSIRRGSGHGTSERWFE* |
| Ga0079219_102614141 | 3300006954 | Agricultural Soil | VKPEQAAKVTMRMPTLLPIGEGCTGREAIDARTCSIRRGSGHGTSEG* |
| Ga0079218_106979201 | 3300007004 | Agricultural Soil | MPTLLPFGEGCMSGEAIDTSTRSIRRGSGHGTSEWWFG* |
| Ga0075435_1006194061 | 3300007076 | Populus Rhizosphere | VTMRMQTLLSEGECSTSGEAIDTRTRLIRRGSGHSTSEG |
| Ga0099793_104680103 | 3300007258 | Vadose Zone Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0099794_104352261 | 3300007265 | Vadose Zone Soil | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLER |
| Ga0099794_105903172 | 3300007265 | Vadose Zone Soil | VTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLER |
| Ga0099795_100258723 | 3300007788 | Vadose Zone Soil | KPEQASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG* |
| Ga0105049_101956411 | 3300007799 | Freshwater | ASKVMMRMPTRPNNGEGSTSGEVIDERTRSIRRGIGHDTLER* |
| Ga0104325_1220933 | 3300007822 | Soil | PEQASKVTMRMPTLLPFGEGCISGEAVDTRTRLIRRGSGHGTSERWFG* |
| Ga0100400_11039123 | 3300007964 | Aquifer | AVTRVKSEQASKVLMRMPTHLNNGKGCMNGQGIDVRPRSIRRGSGHGTLEG* |
| Ga0100398_12596502 | 3300008020 | Aquifer | AIQWAVTRVKSEQASKVLMRMPTHLNNGKGCMNGQGIDVRPRSIRRGSGHGTLEG* |
| Ga0100378_14686751 | 3300008085 | Aquifer | SEQASKVLMRMPTHLNNGEGCMNGQGIDVRPRSIRRGSGHGTLEG* |
| Ga0100377_10422413 | 3300009004 | Aquifer | AIQRAVTRVKSEQASKVLMRMPTRLNNGEGCMNGEGIDGCTRLIRRGSGHSTLER* |
| Ga0105251_106382261 | 3300009011 | Switchgrass Rhizosphere | MQASKVTMRMPTHLPEGEGCMSGEAIDTRTRSIRQGSGHGTS |
| Ga0099829_100274896 | 3300009038 | Vadose Zone Soil | QASKVTMRMPTLLPFGEGCMSGEAIDTRTRLIRRGSGHGTSKRWFG* |
| Ga0099829_103622671 | 3300009038 | Vadose Zone Soil | VKPEQASKVTMRMPTLLPFGEGCTNGEVIDTRTRLIRRGSGHGTLE |
| Ga0115566_102599321 | 3300009071 | Pelagic Marine | VKSEQASKVMMRMLTRLNNGESSTGWEAIDTRTCSIRRGNGHGTLEG* |
| Ga0105240_106533611 | 3300009093 | Corn Rhizosphere | LGGRAIQRAVTRVKPEQASKVKMRMPTRQRYGEGRTDGEAIDEGTHLVRRGNGHGTVER* |
| Ga0111539_112174021 | 3300009094 | Populus Rhizosphere | TMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSEG* |
| Ga0099792_103779821 | 3300009143 | Vadose Zone Soil | TLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| Ga0105091_104883731 | 3300009146 | Freshwater Sediment | MQASKVTMRMPTLLPFGEGCMNGEAIDTRTRSIRRGSGHGTS |
| Ga0111538_102462661 | 3300009156 | Populus Rhizosphere | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG* |
| Ga0075423_101799282 | 3300009162 | Populus Rhizosphere | MRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG* |
| Ga0114925_111137581 | 3300009488 | Deep Subsurface | MRMPTLRPFEEGRTSGEEIDTSTRSIRRGGGHGTSER* |
| Ga0116214_10640881 | 3300009520 | Peatlands Soil | HNELPSGEGCMSGEEIDTRTRSIRRGIGHGTSEQWFG* |
| Ga0116136_11918831 | 3300009547 | Peatland | KSEQASKVAMRTPTHRVFGEGRVDREAIDMSTCLVRRGNGHGTLEW* |
| Ga0105249_121365671 | 3300009553 | Switchgrass Rhizosphere | KVMMRMPTRLHIGEGHVDGEEIDTCTHSIRRGSGHGTLEGWFG* |
| Ga0105340_13069721 | 3300009610 | Soil | MRMPTLLPFGEGRVSGEAIDTSTRLIRRGSGHGTSERWFG* |
| Ga0116135_11362592 | 3300009665 | Peatland | VEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG* |
| Ga0123338_100353392 | 3300009686 | Glacier Valley | VKPEQASKVMMRMPTRLNNGEGRTGGEEIDERTRSIRRGNGHGTLEW* |
| Ga0116226_114795032 | 3300009787 | Host-Associated | VKPEQASKVKERMPTRLNNGEGSMSREAIDACTCSIRRGIGHGTLEW* |
| Ga0105078_10139571 | 3300009823 | Groundwater Sand | PFGEGCMSGEAIDTRTRSIRRGSGHGHSAKHASGMTERWFG* |
| Ga0126315_102645171 | 3300010038 | Serpentine Soil | KPEQASKVAMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSEG* |
| Ga0126315_108114972 | 3300010038 | Serpentine Soil | VKPEQASKVKMRMPTRQRYGEGRTDGEAIDASTRPVRRGNGHGTPEG* |
| Ga0126380_102734692 | 3300010043 | Tropical Forest Soil | TRVKPEQASKVTMRMPTLLPFGEGRMSGEAIDTRTRSIRRGSGHSTPRKVVRG* |
| Ga0126384_100957301 | 3300010046 | Tropical Forest Soil | VTMRMATLLSEGEGCMSGEAIDTRTRSIHRGSGHGTSEGWFVVS |
| Ga0126382_101171921 | 3300010047 | Tropical Forest Soil | KVTMRMPTLLPFGEGRVSGEAIDARTRSIRRGSGLGTSEKWFG* |
| Ga0127443_10673201 | 3300010125 | Grasslands Soil | EQASKVMMRMPTRLDNGEGRVNGEAIDICTHSIRRGSGHGTVEGWFG* |
| Ga0126318_109303521 | 3300010152 | Soil | MRMPTRLQNGEGRTDGEEIDNRTRPIRRGIGHGTPEG* |
| Ga0126318_110524492 | 3300010152 | Soil | RVKPEQASKVEMRMPTRLQNGEGRTDGEEIDNRTHPVRRGIGHGTPEG* |
| Ga0099796_100236731 | 3300010159 | Vadose Zone Soil | SPPPHSISKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG* |
| Ga0134067_102032051 | 3300010321 | Grasslands Soil | QESAVGRAATLQAVTRVKPEQASKVKMRTPTRLSNGEGRVNGEAIDARTRSVRRGMWHGTLEG* |
| Ga0074046_106397991 | 3300010339 | Bog Forest Soil | KPEQASKVTMRMPTLLPFGEGRVSGEAIDMSTRSICRGSGLGTPER* |
| Ga0074044_100533862 | 3300010343 | Bog Forest Soil | MRWAVTCVKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0126377_101894891 | 3300010362 | Tropical Forest Soil | LETDKASKVTMRMPTLRPFGEGCTSGEAIDTRTRLIRRGSGHGTSEKWFE* |
| Ga0126377_106327561 | 3300010362 | Tropical Forest Soil | KVTMRMPTNRPNWEGCMSGEEIDTRTRSIRRGIGHGTSER* |
| Ga0126377_108907492 | 3300010362 | Tropical Forest Soil | EQASKVTMRMPTLRPFGEGCMSGEAIDARTRLIRRGSGRGTPERWFG* |
| Ga0126379_118886881 | 3300010366 | Tropical Forest Soil | KPEQASKSTVRMSTRPKCGEDRVNGEAIDRGNGHSTLEW* |
| Ga0126381_1006649942 | 3300010376 | Tropical Forest Soil | SKVTMRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG* |
| Ga0126359_15622201 | 3300010869 | Boreal Forest Soil | KVMMRMPTRLNNGEGRVDGEAIDMCTRSIRRGSGHCTLERWCG* |
| Ga0126350_108246481 | 3300010880 | Boreal Forest Soil | MKPEQASKVKMRMPTRQRNGEGSTDWEAIDASTDPIRRGNGHGTPEG* |
| Ga0133913_107233502 | 3300010885 | Freshwater Lake | VKPEQASKVMMRMPTRLNNGEGSTSGEDIDERTRSIRRGSRHGTLEW* |
| Ga0150983_102908382 | 3300011120 | Forest Soil | AVTQVKPEQASKSIMRMPTRPKCGEGRVNGEVIDMSTRSIRRGNGHSTLEG* |
| Ga0137489_10229022 | 3300011249 | Basal Ice | MMRMPTRLNNGEGRTGGEEIDERTRSIRRGNGHGTLEW* |
| Ga0137391_107929912 | 3300011270 | Vadose Zone Soil | RMPTRLQNGEGRTDGEAIDTCTRPIRRGSGHGTLEGCFG* |
| Ga0137438_12276621 | 3300011431 | Soil | RVNPEQASKVKMRMPTRQRYGEGCPDGEAIDASTHPIRRGNGHGTLER* |
| Ga0153774_11028892 | 3300012002 | Saline Lake Microbial Mat | VKPEQASKVKSRMPTRLRNGEGRVGREAIDTSTCPIRRGSGHGTLER* |
| Ga0120192_100002031 | 3300012021 | Terrestrial | VMRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDMSTRSVRRGSGLGTSERWFG* |
| Ga0137389_107709261 | 3300012096 | Vadose Zone Soil | SKVTMRMPTLLPFGEGCTNGEVIDTRTRLIRRGSGHGTLERFG* |
| Ga0136598_10123443 | 3300012170 | Saline Lake | EQASKVMMRMLTRLSNGESSTGWEAIDTRTCSIRQGSGHGTLEG* |
| Ga0137327_11444111 | 3300012173 | Soil | MQASKVTMRMPTLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSER |
| Ga0137388_109155141 | 3300012189 | Vadose Zone Soil | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFE* |
| Ga0137383_100521306 | 3300012199 | Vadose Zone Soil | VTRVKPEQASKVTMRMPTLLPFGEGCTNGEVIDTRTRLIRRGSGHGTSEMWFE* |
| Ga0137365_101300802 | 3300012201 | Vadose Zone Soil | EQASKSMMWMPTRPKCGEGRVNGEVIDTSSRSIRRGNGHSTLEG* |
| Ga0137363_110051741 | 3300012202 | Vadose Zone Soil | ASKVTMRMPTLLPFGEGSMSGEAIDTRTRSIRRGSGHGTTERWFG* |
| Ga0137399_106260011 | 3300012203 | Vadose Zone Soil | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0137399_109805621 | 3300012203 | Vadose Zone Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGT |
| Ga0137374_107719841 | 3300012204 | Vadose Zone Soil | QASKVKMRMPTRQRNGEGRTDGEAIDASTCPIRRGNRNGTLER* |
| Ga0137376_105293162 | 3300012208 | Vadose Zone Soil | KPEQASKVKMRMPTRQRNGEGRTDGEAIDVSTCPIRRGNGNGTLER* |
| Ga0137376_113143702 | 3300012208 | Vadose Zone Soil | RAVTRVKPEQASKVKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG* |
| Ga0137379_106765532 | 3300012209 | Vadose Zone Soil | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTS |
| Ga0137379_107159092 | 3300012209 | Vadose Zone Soil | VKPEQASKVTMRMPTLLPFGEGCTNGEVIDTRTRLIRRGSGHGTLERF |
| Ga0137378_104026012 | 3300012210 | Vadose Zone Soil | VKPEQASKEPMRMPTLLPFGEGRASGEAIDKCTRLICRGSGHGTSERWFG* |
| Ga0137378_104893991 | 3300012210 | Vadose Zone Soil | KPEQASKVTMRMPTLLPFGEGRVSGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0150985_1079545592 | 3300012212 | Avena Fatua Rhizosphere | ASKVTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSEG* |
| Ga0150985_1136439962 | 3300012212 | Avena Fatua Rhizosphere | MRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSE |
| Ga0150985_1192359001 | 3300012212 | Avena Fatua Rhizosphere | VMMRMPTRLHNGEGHVDGEEIDTCTHSIRRGSGHGTLEGWFG* |
| Ga0137366_101831624 | 3300012354 | Vadose Zone Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDTSTRSIRRGSGHGTLEG* |
| Ga0137366_106181631 | 3300012354 | Vadose Zone Soil | KPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSERWFG* |
| Ga0137384_113380852 | 3300012357 | Vadose Zone Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDMSTRSIRRGSGHGTSEG* |
| Ga0137375_110066081 | 3300012360 | Vadose Zone Soil | AIRRAVTRVKPEQASKVTMRMPTLLPFGEGCTSGEVIDKRARSIRRGSGHGTLERWFG* |
| Ga0137360_113434592 | 3300012361 | Vadose Zone Soil | VKPEQASKVTMRVPTLLPFGEGCMSGEEIDIRTRSIRRGSGHGTSERWFG* |
| Ga0137361_101025896 | 3300012362 | Vadose Zone Soil | IRRAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHSTSERWFG* |
| Ga0137361_103481221 | 3300012362 | Vadose Zone Soil | MRMPTLLPFGEGRVSGEVIDMSTRSIRRGSGHGTS |
| Ga0134026_10348631 | 3300012381 | Grasslands Soil | MWVKPEQASKVKMRMPTRQRNGEGRTDGEAIDVSTCPIRRGNGNGTLER* |
| Ga0134050_13694402 | 3300012407 | Grasslands Soil | VKPEQASKVKMRMPTRQRNGEGRTDGEAIDVSTCPIRRGNGHGTVER* |
| Ga0150984_1090042473 | 3300012469 | Avena Fatua Rhizosphere | RVKPEQASKVEMRMPTRLQNGEGRTDGEAIDARTCPIRRGSGHGTPEG* |
| Ga0150984_1176510221 | 3300012469 | Avena Fatua Rhizosphere | MMRMPTRLNNGEGRTSGEEIDERTRSIRRGNGHGTLEW* |
| Ga0137398_101815031 | 3300012683 | Vadose Zone Soil | IRRAVTCVKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0160427_102465061 | 3300012894 | Solar Cell Surface | AVMCVKPEQASKVMMRMPTRLNNGEGSMSGEEIDECTRSIRRGNGHGTLEW* |
| Ga0157285_103154172 | 3300012897 | Soil | PEQASKVMTRMPTRLSFGEGCTDGEAIDMSTRPIRRGSGHGTPER* |
| Ga0137394_102553321 | 3300012922 | Vadose Zone Soil | PEQASKVTMRMPTLLPFGEGRASGEAIDTRTRSIRRGSGHGTLERWFG* |
| Ga0137416_101650753 | 3300012927 | Vadose Zone Soil | EQASKVTMRMPTLRPFGEGCMSGEAIDTRTRLIRRGSGRGTPERWFG* |
| Ga0137416_102325851 | 3300012927 | Vadose Zone Soil | MRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLE |
| Ga0126375_112077701 | 3300012948 | Tropical Forest Soil | VTMRMQTLLPFGECSMSGEAIDTRTRLIRRGSRHSTSEG |
| Ga0164300_101354533 | 3300012951 | Soil | VKPEQASKVTMRMPTLRPFGEGCMSGEAIDTRTRLIRRGSGHGTSGWWFG* |
| Ga0126369_126625711 | 3300012971 | Tropical Forest Soil | MRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGYGTSER* |
| Ga0164308_100229621 | 3300012985 | Soil | VTRVKPEQASKVMMRMPTRLNFGEGRVNGEAIDRCTRSIRRGNGHGTSEG* |
| Ga0164304_101685492 | 3300012986 | Soil | EQASKVTMRMPTLRPFGEGCMNGEAIDTRTRSIRRGSEHGTSERWFG* |
| Ga0164307_109185752 | 3300012987 | Soil | LGGGEIRWAVTRVKPEQASKVMMRMPTRLNFGEGRVNGEAIDRCTRSIRRGNGHGTSEG* |
| Ga0164297_1000035823 | 3300013094 | Freshwater | VKPEQASKVKERMPTRLNNGEGSTSGEAIDARTRSIRRGNGHGTLEG* |
| Ga0181517_102056342 | 3300014160 | Bog | MRMPTRLETGEGSMDGEEIDASTRLIRRGIGHGTPKR* |
| Ga0075309_10047552 | 3300014268 | Natural And Restored Wetlands | RAVTRVKPEQASKVTMRMPTRLPFGEGCMCVEAIDTRTRSIRRGSGHGTSERWFG* |
| Ga0075353_11309572 | 3300014321 | Natural And Restored Wetlands | SEQASKVKSRMPTHLHNGEGRVDGEAIDVYTRSIRRGSGHGTLEG* |
| Ga0157380_105789231 | 3300014326 | Switchgrass Rhizosphere | PDQAWKVTMRMPTLLPFGEGRVGGEAIDTGTRSIRRGSGHGTSERWFG* |
| Ga0167669_100550711 | 3300015024 | Glacier Forefield Soil | VKPEQASKVMMRMPTRLDNGEGRTGGEEIDERTRSIRRGNGHGTLEW* |
| Ga0167663_10100261 | 3300015202 | Glacier Forefield Soil | VKPEKASKVMMRMPTRLNNGEGRTGGEEIDERTRSIRRGNGHGTLEW* |
| Ga0167663_11060081 | 3300015202 | Glacier Forefield Soil | EKASKVMMRMPTRLNNGEGRTGGEEIDERTRSIRRGNGHGTLEW* |
| Ga0132257_1044430911 | 3300015373 | Arabidopsis Rhizosphere | LCTGKMRTPTHLSYGEGRVNWEAIDARTRSVRRGMWHGTLE |
| Ga0182041_101801162 | 3300016294 | Soil | MPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTSEG |
| Ga0182041_120233562 | 3300016294 | Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDTRTRSIRRGSGLGTSEA |
| Ga0182033_101552523 | 3300016319 | Soil | RRAVTRVKPEQAPKVTMRMPTLLPFGEGRVSGEAIDARTCSIRRGSGHGTPERWFG |
| Ga0182035_101263541 | 3300016341 | Soil | SKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTPERWFG |
| Ga0182037_101729531 | 3300016404 | Soil | SKVTMRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTSER |
| Ga0181503_10231231 | 3300016698 | Peatland | VKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0181500_13146841 | 3300016728 | Peatland | MRMPTRLETGEGSMDGEEIDASTRSIRRGIGHGTPER |
| Ga0187801_103947511 | 3300017933 | Freshwater Sediment | MRMPTRPKCGEGRVKGEVIDMSTLSIRRGNGHSTLE |
| Ga0190266_104821001 | 3300017965 | Soil | RAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0187783_112239611 | 3300017970 | Tropical Peatland | VKPEQAPKVTMRMPTLLPFGEGCTDREAIDARTCLIRRGSGHGTSE |
| Ga0187780_103893712 | 3300017973 | Tropical Peatland | MTWMPTRQNNGEGRVDGEAIDRCTRSIPRGNGNGALE |
| Ga0187822_103443841 | 3300017994 | Freshwater Sediment | VTRVKPEQASKSIMRMPTRPKCGEGRVKGEVIDMSTLSIRRGNGHSTLEG |
| Ga0187767_100189902 | 3300017999 | Tropical Peatland | EQASKVTMRMPTLRPFGEGCTRGEAIDARTHAIRRGSGHGTSEEWFG |
| Ga0184608_102105531 | 3300018028 | Groundwater Sediment | PEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSER |
| Ga0187788_102423781 | 3300018032 | Tropical Peatland | KPEQASKSIMRMPTRPKWGEGHVNGEVIDTSTHSIRRGNGHSTLEG |
| Ga0187890_103318552 | 3300018044 | Peatland | RMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0187851_108616301 | 3300018046 | Peatland | KVTMRMPTRLETGEGSMDGEEIDASTRLIRRGIGHGTPKR |
| Ga0184626_102775911 | 3300018053 | Groundwater Sediment | RMLTLLPFGESIMSGEVIDTRTRSIRRGSRHGTSERWFG |
| Ga0187784_108343361 | 3300018062 | Tropical Peatland | MRVKPEQASKVLMWMPTRRAIGEGRTDRESIDARACPIRRGSGRGTREERDGQQGRPGR |
| Ga0184639_100855932 | 3300018082 | Groundwater Sediment | RAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLICRGSGHGTSEG |
| Ga0187772_102413421 | 3300018085 | Tropical Peatland | MRMPTRLQNGEGSTDGEAIDERTHSIRRGSGHGTQER |
| Ga0190265_101971073 | 3300018422 | Soil | IQQAVTRVKPEQASKVNLRMPTRLRFGEGSMGGEAIDARTRSVRRGSGHGMLER |
| Ga0190269_101083773 | 3300018465 | Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLICRGSGHGTSEG |
| Ga0190268_110816922 | 3300018466 | Soil | VTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSE |
| Ga0190271_137326461 | 3300018481 | Soil | TSVKPEQASKVMMRMPTLLRLGEGSMSGEAIDECTRSIRRGSGHGTLEG |
| Ga0184576_1199271 | 3300019156 | Soil | RVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0184581_1202451 | 3300019163 | Soil | KPEQASKVEMRMPTRLQNGEGSMDGEAIDARTRSIRRGSGHGTPEG |
| Ga0184598_1035922 | 3300019182 | Soil | EQASKVEMRMPTRLQNGEGSMDGEAIDARTRSIRRGSGHGTPEG |
| Ga0184599_1491531 | 3300019188 | Soil | AVTRVKPEQASKVEMRMPTRLQNGEGSMDGEAIDARTRSIRRGSGHGTPEG |
| Ga0181501_11405591 | 3300019230 | Peatland | MRMPTRLETGEGSMDGEEIDASTRLIRRGIGHGTPKR |
| Ga0180115_11903842 | 3300019257 | Groundwater Sediment | PTLLPFGEGRVSGEAIDMSTRLIRRGSGLGTSERWFG |
| Ga0180115_13668961 | 3300019257 | Groundwater Sediment | TLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSERWFG |
| Ga0184647_14867611 | 3300019263 | Groundwater Sediment | KVTMRMPTLLPFGEGRVSGEAIDMRTRSIRRGSGHGTSER |
| Ga0181514_14627822 | 3300019268 | Peatland | VKPEQASKVTMRMPTRLETGEGSMDGEEIDASTRLIRRGIGHGTPKR |
| Ga0184644_14995122 | 3300019269 | Groundwater Sediment | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSERWFG |
| Ga0181512_12638831 | 3300019270 | Peatland | IRRAVTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0193756_10087871 | 3300019866 | Soil | AIRRAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0193713_10268443 | 3300019882 | Soil | KVTMRMPTLLPVGEGRVSGEAIDMRTRLICRGSGHGTSEG |
| Ga0193692_10382302 | 3300020000 | Soil | EQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLICRGSGHGTSEG |
| Ga0193733_10297803 | 3300020022 | Soil | VTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0211557_100302661 | 3300020418 | Marine | KPEQASKVMMRMLTRLSNGESSTGWEAIDTRTCSIRRGSGHGTLEG |
| Ga0214258_113839531 | 3300020817 | Food Waste | VTKADVGGLAIQRAVTSVKPEQASKVKMRMPTRLNNGEGSTSGEAIDARTRTIRRGSGHGTLEG |
| Ga0210381_101393742 | 3300021078 | Groundwater Sediment | EQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0210380_100879841 | 3300021082 | Groundwater Sediment | RRAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLICRGSGHGTSEG |
| Ga0179596_100446993 | 3300021086 | Vadose Zone Soil | AIRWAVTCVKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG |
| Ga0210408_103036792 | 3300021178 | Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0210387_101679462 | 3300021405 | Soil | MRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGLGTS |
| Ga0210402_116608842 | 3300021478 | Soil | RQYELPSGEGFMSGEAIDTRTRLIRRGSGLGTSERWFG |
| Ga0126371_102954052 | 3300021560 | Tropical Forest Soil | QRAVTRVKSEQASKSIMRMPTRPKCGEGRVNGEVIDMSTRSIRRGNGHSTLEG |
| Ga0224508_103944542 | 3300022413 | Sediment | ASKVSMRMPTLLPFGEGRVSGEEIDMSTHSIRRGSGHGTPER |
| Ga0242660_10064803 | 3300022531 | Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFG |
| Ga0224452_10574872 | 3300022534 | Groundwater Sediment | RRAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSER |
| Ga0212090_100559572 | 3300022561 | Glacier Valley | VKPEQASKVMMRMPTRLNNGEGRTGGEEIDERTRSIRRGNGHGTLEW |
| Ga0224569_1039352 | 3300022732 | Rhizosphere | AVTRVKLEQASKVKMRTPTRLSYGEGRVNGEAIDERTRSVRRGSGHGTLEG |
| Ga0222622_100602823 | 3300022756 | Groundwater Sediment | VKPEQASKVTMRMPTLLPFGEGRASGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0224561_10076722 | 3300023030 | Soil | KLEQASKVKMRTPTRLSYGEGRVNGEAIDERTRSVRRGSGHGTLEG |
| Ga0233345_10360601 | 3300024045 | Leaf Litter | GRAIQRAVTSVKPEQASKVMMRMPIHLNDGEGSMSGEAIDTRTRSIRRGNGHGTPER |
| Ga0210095_11261982 | 3300025568 | Natural And Restored Wetlands | VKPEQASKVMMWMSTRLNNGEDSTSGEEIDERTRSIRRGNGHGTLEW |
| Ga0209176_100066891 | 3300025854 | Arctic Peat Soil | VTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHG |
| Ga0207692_111265511 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTLLPFGEGCTSGEAIDTRTRSIRRGSGRGTSERWFG |
| Ga0207693_101591382 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG |
| Ga0207662_102521832 | 3300025918 | Switchgrass Rhizosphere | MRMPTRLHNGEGHVDGEEIDTCTHSIRRGSGHGTLE |
| Ga0207649_112455761 | 3300025920 | Corn Rhizosphere | THLPEGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG |
| Ga0209804_13447022 | 3300026335 | Soil | VTRVKPEQAPKVKMRTPTRLSNGEGRVNGEAIDARTRSVRRGMWHGTLEG |
| Ga0257179_10017061 | 3300026371 | Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0257179_10024134 | 3300026371 | Soil | ISKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0257172_10487373 | 3300026482 | Soil | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0257160_10028161 | 3300026489 | Soil | SKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0257153_10168731 | 3300026490 | Soil | YELPSGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0257157_10037993 | 3300026496 | Soil | MRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0257165_10090131 | 3300026507 | Soil | QASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0209056_103611792 | 3300026538 | Soil | VTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSEG |
| Ga0207801_1116782 | 3300026810 | Tropical Forest Soil | MRMPTLLPFGEGRVSGEAIDMGTRSIRRGSGLGTSEGWFG |
| Ga0207765_1088221 | 3300026819 | Tropical Forest Soil | EQASKVKVWMPTRLSNGEGRADGEAIDARTRLIHRGSGHGTLEG |
| Ga0208404_10014831 | 3300026855 | Soil | ASKVTMRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSERWFG |
| Ga0207787_10088372 | 3300026908 | Tropical Forest Soil | MMRMPTRRNLGEGRTDGEAIDARSHPIRRGNGHGTLEG |
| Ga0207852_10053071 | 3300026959 | Tropical Forest Soil | ASKVTMRMPTLLPFGEGRVSGEAIDMGTRSIRRGSGLGTSEGWFG |
| Ga0207839_10017983 | 3300027010 | Tropical Forest Soil | MRMPTLLPFGEGSMSGEAIDMNTRSIRRGSGLGTSER |
| Ga0209111_10173761 | 3300027058 | Forest Soil | VKPEQASKVEMRMPTRLQNGEGRTDGEEIDKRTRPIRRGIGHGTPEG |
| Ga0208241_10085261 | 3300027297 | Forest Soil | VKPEQASKSIMRMPTRPKCGEGRVNGEVIDMSTRSIRRGNGHSTLEG |
| Ga0208993_10278392 | 3300027480 | Forest Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDTRTRLIRRGSGHGTSERWFG |
| Ga0207981_10290301 | 3300027560 | Soil | VTFVKPEQASKVTMRMPTLRPFGEGCMSGEAIDTRTRSIRRGSGHGTSEGWFG |
| Ga0209422_10585451 | 3300027629 | Forest Soil | KPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSEKWFG |
| Ga0209625_10188731 | 3300027635 | Forest Soil | TRVKSEQASKVTMRMPTLRPFGEGCMSGEAIDMSTRSIRRGSGHGTSERWFG |
| Ga0209117_11718742 | 3300027645 | Forest Soil | PEQASKVTMRMPTLLPYGEGCMSGEAIDMRTRLIRRGSGHGTSERWFG |
| Ga0209799_10113043 | 3300027654 | Tropical Forest Soil | VTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDACTCSIRRGSGHGTWERWFG |
| Ga0209799_10123491 | 3300027654 | Tropical Forest Soil | VTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG |
| Ga0208989_100030741 | 3300027738 | Forest Soil | KVTMRMPTLLPFGEGCMSGEAIDTRTRLIRRGSGQGTSGWWFG |
| Ga0209772_100495191 | 3300027768 | Bog Forest Soil | KLEQASKVTMRMPTLRPFGEGCMSGEAIDTRTCLIRRGSGHGTSERWFG |
| Ga0209273_102086591 | 3300027790 | Marine Sediment | EDEAQAVTRVKSEQASKATMRMATLRPFGEGSTSGDEIEMRTCSIRRGSGHGAPERWFG |
| Ga0209139_100114781 | 3300027795 | Bog Forest Soil | VKPEQASKVEMRMPTRLQNGEGSMDGEAIDARTRSIRRGSGHGTPEG |
| Ga0209139_102831441 | 3300027795 | Bog Forest Soil | ASKVMMRMPTRLNNGEGRVDGEAIDTRTRSIRRGSGHGTLERWCG |
| Ga0209354_101756222 | 3300027808 | Freshwater Lake | VKPEQASKVMMRMPTRLNNGEGRTSGEEIDERTRSIRRGNGHGTLEW |
| Ga0209344_100088749 | 3300027834 | Marine | VKPEQASKVMMRMLTRLNFGESSTCGEVIDTCTRTIRRGNGHGTLEG |
| Ga0209066_105108682 | 3300027851 | Watersheds | PEQASKVMMRMPTRLNNGEGSTSGEAIDARTRTIRRGSGHGTLEG |
| Ga0209274_100631252 | 3300027853 | Soil | RRAVTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDKCTRSIRRGSGHGTPEW |
| Ga0209701_100569481 | 3300027862 | Vadose Zone Soil | PEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSKRWFG |
| Ga0209813_100833442 | 3300027866 | Populus Endosphere | QASKVKMRMPTRQRYGEGRTGGEAIDARTHLIRRGNGHGTVEG |
| Ga0209048_103247483 | 3300027902 | Freshwater Lake Sediment | VKPEQASKVTMWMPTLRVTGEGCMSGEAIDTRTRSIRRGSGHGTSERWFE |
| Ga0209583_100329932 | 3300027910 | Watersheds | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGRGTSERWFG |
| Ga0209583_103568222 | 3300027910 | Watersheds | VKPEQASEVPMRMPTHRSNGEGRTRGEAIDTRTHAIRRGSGHGTLEWWFG |
| Ga0209168_100831712 | 3300027986 | Surface Soil | KPEQAPKVTMRMPTLLPFGEGCTNREAIDARTCLIRRGSGHGTLEG |
| Ga0265346_1033882 | 3300028012 | Plant Litter | RAVTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0302145_103175262 | 3300028565 | Bog | VKPEQASKVKMRMPTRLNFGEGSTSGEEIDERTRSIRRGSGHGTLEG |
| Ga0265309_102102902 | 3300028599 | Sediment | MRLPTLLPFGEGRVGGEVIDMSTRLIRRGSGHGTPER |
| Ga0302202_100516382 | 3300028762 | Bog | VKPEQASKVKERMPTRLNNGEGSTSGEAIDARTRSIRRGNGHGTLEG |
| Ga0302202_101397302 | 3300028762 | Bog | EQASKVMMRMPTRLNNGEGCTDGEAIDMCTRSIRRGGGHGTLEG |
| Ga0307323_100327201 | 3300028787 | Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDTSTRSIRRGSGHGTSEKVIRVIGGDPS |
| Ga0307296_101035221 | 3300028819 | Soil | KVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSERWFG |
| Ga0307289_100986662 | 3300028875 | Soil | TLLPFGEGRVSGEAIDTRTRSIRRGSGHGTLERWFG |
| Ga0308309_110998162 | 3300028906 | Soil | RMPTLLPFGEGRVSGEAIDARTRSIRRGSGLGTSGKWFG |
| Ga0308309_115076011 | 3300028906 | Soil | VTRVKPEQASKVEMRMPTRLQNGKGRTDGEAIDKCTRSISRGSGHGTPEW |
| Ga0247028_10239031 | 3300029894 | Cryconite | VKPEQASKVMMRMPTRLNSGEGRTGGEEIDERTRSIRRGNGHGTLEW |
| Ga0311358_102010302 | 3300029915 | Bog | ASKVMMRMPTRLNNGEGCTDGEAIDMCTRSIRRGGGHGTLEG |
| Ga0302150_101737902 | 3300029956 | Bog | VEMRMPTHLQNGEGSTDGEAIDKRTHPIRRGSGHGTSERWFG |
| Ga0268244_106391352 | 3300030501 | Agave | MCVKLEQASKVMMRMPTRLNNGEGGMSGEEIDEGTRSIRRGSGHGTLEW |
| Ga0310038_104421441 | 3300030707 | Peatlands Soil | MRMPTLQSEGEGRAGGEEIDTRIRSIRRGIGHGTSTPQGPSG |
| Ga0265763_10106571 | 3300030763 | Soil | RRAVTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0075377_117741331 | 3300030844 | Soil | VKPEQASKVTMRMPTLLPFGEGRVGGEAIDMRTRLIRRGSGHGTSEG |
| Ga0265758_1019532 | 3300030884 | Soil | EQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0265743_1042051 | 3300030885 | Soil | ASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0265768_1034201 | 3300030963 | Soil | KPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0075394_120974581 | 3300030969 | Soil | QASKVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGLGTSEG |
| Ga0099845_10046081 | 3300030975 | Boreal Forest Soil | VKPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSEKWFG |
| Ga0308190_10696522 | 3300030993 | Soil | KVTMRMPTLLPFGEGRVSGEAIDTRTRSIRRGSGHGTSERWFG |
| Ga0265732_1010172 | 3300031016 | Soil | VTRVKPEQASKVEMRMPTRLQNGEGRTDGEAIDTCTRSIRRGSGHGTPEG |
| Ga0308192_10214032 | 3300031082 | Soil | RLHNGEGHVDGEVIDTCTHSIRRGSGHGTLEGWFG |
| Ga0265760_100210721 | 3300031090 | Soil | PEQASKVTMRMPTLRPFGEGCMSGEAIDARTRPIRRGSGHGTSERWFG |
| Ga0308204_101158291 | 3300031092 | Soil | VKSEQASKVMMRMPTRLHNGEGHVDVEEIDTCTHSIRRGSGHGTLEGWFG |
| Ga0308204_101807181 | 3300031092 | Soil | VMMRMPTRLNNGEGRVNGESIDICTHSIRRGSGHGTSERWFG |
| Ga0308197_100935321 | 3300031093 | Soil | VKPEQASKVKMRMPTRQRYGEGRTGGEAIDARTHLIRRGNGHGTVEG |
| Ga0170824_1224698642 | 3300031231 | Forest Soil | VKPEQASKVTMRMPTLRPFGEGCMSGEAIDTRTRSIRRGSEHGTSERWFG |
| Ga0307446_10260534 | 3300031354 | Salt Marsh | KPEQASKVKMRTPTRLRFGEGRANGEAIDRSTRSVRRGSGHGTPER |
| Ga0308194_100085333 | 3300031421 | Soil | ASKVTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGHGTSEG |
| Ga0170820_151720272 | 3300031446 | Forest Soil | MRMPTLLPFGEGRVSGEAIDKSTRSIRRGSGHGTSE |
| Ga0307513_107008392 | 3300031456 | Ectomycorrhiza | VKPEQASKVSMRMPTLRPFGEGCMRGEAIDARTHAIRRGSGHGTSEGWFVV |
| Ga0272428_10367561 | 3300031520 | Rock | VKLWTPTRLNYGEGRVDGEGIDTCTRSVRRGNGHGTLEGWCG |
| Ga0318528_100618031 | 3300031561 | Soil | MRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTSER |
| Ga0318555_107353661 | 3300031640 | Soil | EQASKVKSRMPTRLHNGEGRTDGEAIDMCTRSIRRGNGHGTLER |
| Ga0318542_104711052 | 3300031668 | Soil | VLMRMPTLLPFGEGCMNGEAIDTRTRLIRRGSGHGTSERWFG |
| Ga0307480_10205302 | 3300031677 | Hardwood Forest Soil | AIRRAETSVKPEQASKVTMRMPTLRGMGEGRMSGEVIDTRTRSIRRGSGLGTPER |
| Ga0318561_104015421 | 3300031679 | Soil | TRVKPEQASKVTMRMPTLLPFGEGRVRGEAIDMSTRSIRRGSGHGTSER |
| Ga0318572_100910902 | 3300031681 | Soil | PEQAPKVTMRMPTLLPFGEGRVSGEAIDARTCSIRRGSGHGTPERWFG |
| Ga0318560_107102641 | 3300031682 | Soil | MRMPTLLPFGEGRASGEVIDKRTRSIRRGSGLGTSEA |
| Ga0310686_1149978112 | 3300031708 | Soil | EMRMPTRLQNGEGSMDGEAIDARTRSIRRCSGHGTPAG |
| Ga0307469_116469331 | 3300031720 | Hardwood Forest Soil | MRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSEG |
| Ga0306918_100581474 | 3300031744 | Soil | KPQQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG |
| Ga0306918_105794172 | 3300031744 | Soil | VTMRMLTLLPFGEGCTSGEAIDTRTRLIRRGSGHGTSER |
| Ga0307475_112377092 | 3300031754 | Hardwood Forest Soil | EQASKVEMRMPTRLQNGEGRTDGEAIDKRTCSIRRGSGHGTPEW |
| Ga0318537_100455471 | 3300031763 | Soil | QASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG |
| Ga0318498_100529261 | 3300031778 | Soil | VTMRMPTLLPFGEGCTSGEAIDTRTRLIRRGSGHGTSERW |
| Ga0318547_106719982 | 3300031781 | Soil | MRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTS |
| Ga0318548_101483942 | 3300031793 | Soil | PEQASKVTMRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTSEG |
| Ga0318557_103000501 | 3300031795 | Soil | RVKPEQASKVTMRMPTLLPFGEGRVRGEAIDMSTRSIRRGSGHGTSER |
| Ga0318550_100553932 | 3300031797 | Soil | VTRVKPEQASKVTMRMPTLLPFGEGRVSGEAIDARTRSIRRGSGHGTSERWFG |
| Ga0318523_106076091 | 3300031798 | Soil | VKPEQASKSIMRMPTRPKCGEGRVNGEVIDMSTRSIRRGNGRSTLER |
| Ga0307473_110592031 | 3300031820 | Hardwood Forest Soil | EQASKVTMRMPTLLLQGEGRVSGEAIDKSTRSIRRGSGHGTLERWFG |
| Ga0318512_100526681 | 3300031846 | Soil | VTMRMPILLPFGEGRVSGEAIDMSTRSIRRGSGHGTSER |
| Ga0306919_111342491 | 3300031879 | Soil | LLPFGEGCVSGEVIDMSTRSIRRGSGRGTSERWFG |
| Ga0306925_116158771 | 3300031890 | Soil | MRMPTLLPFGEGRVSGEAIDMSIRSIRRGSGHGTS |
| Ga0318536_105266801 | 3300031893 | Soil | VTMWMPTLLPFGEGCTSGEVIDTCTRSIRRGSGHSTSEGWFVVIG |
| Ga0306923_106447152 | 3300031910 | Soil | KPEQASKVTMRMPTLLPFGEGCMSGEAIDTRTRSIRRGSGHGTSEG |
| Ga0310912_102038302 | 3300031941 | Soil | MRMLTLLPFGEGCMSGEEIDKPTRSIRRGSGHGTSE |
| Ga0310916_109214622 | 3300031942 | Soil | VKPEQASKVTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGRGTLER |
| Ga0310910_101988643 | 3300031946 | Soil | VTMRMQTLLRFGECSMSEEVIDTRTRLIRRGSGHGTSEG |
| Ga0310910_108075551 | 3300031946 | Soil | PGQASKVTMRMPTLLPFGEGRVSGEAIDMSTRSIRRGSGHGTSER |
| Ga0318531_100790161 | 3300031981 | Soil | VKLEQASKVKVRTSTRLNNGKAARTGKEIDMCTRLVRRGNGHGTPE |
| Ga0318556_104563832 | 3300032043 | Soil | AIRRAVTRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDMSSRSIRRGSGHGTSEG |
| Ga0310890_118635362 | 3300032075 | Soil | QRAVTRVKPEQASKVKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG |
| Ga0306924_120536181 | 3300032076 | Soil | TRVKPEQASKVTMRMPTLLPFGEGRVSGEVIDMRTRSIRRGSGLGTSEA |
| Ga0311301_1007433413 | 3300032160 | Peatlands Soil | TRHNELPSGEGRVSGEEIDARTRSIRRGIGHGMSEQWFG |
| Ga0311301_117234351 | 3300032160 | Peatlands Soil | EQASKVAMRTPTHRVFGEGRVDREAIDMSTCLVRRGNGHGTLEW |
| Ga0307470_110788602 | 3300032174 | Hardwood Forest Soil | AVTRVKSEQASKVKMRTPTRLSYGEGRVNWEAIDARTRSVRRGMWHGTLEG |
| Ga0306920_1009846232 | 3300032261 | Soil | ASKVTMRMPTLLPFGEGRVSGEAIDARTRSIRRGSGLGTSER |
| Ga0306920_1016905441 | 3300032261 | Soil | VTMRMPTLLPFGEGRVSGEAIDMRTRLIRRGSGRGTLER |
| Ga0335395_107148391 | 3300032431 | Freshwater | QASKVMMRMPTRLNNGEGSTSGEVIDERTRSIRRGNRHGTLER |
| Ga0335083_106368962 | 3300032954 | Soil | KPEQASKVKMWMPTRQNNGEGRVDGEAIDTCTRSIHRGSGNGTLEGRCG |
| Ga0334978_0002636_1920_2072 | 3300033979 | Freshwater | MKPERASKVMMRVPTRLNFGKGSAGRREVDKRTRSIHRGSGHGALELRTG |
| Ga0334940_096905_438_590 | 3300034025 | Biocrust | VKSEQASKVMMRMPTRLHNGEGRVDGEAIDIGTHSIRRGSGHGTLEGWFG |
| Ga0334958_051612_746_874 | 3300034141 | Biocrust | MMRMPTRLHNGEGRVDGEAIDICTHSIRRGSGHGTLEGWFGQS |
| Ga0334938_076941_538_645 | 3300034236 | Biocrust | RLHNGEGRVDGEAIDTCTHSIRRGSGHGTLEGWFG |
| Ga0364943_0004060_2443_2586 | 3300034354 | Sediment | MKPEQASKVLMRMPTLRSFGEGRTCGEAIDTRTHAIRRGSGHGTSVG |
| ⦗Top⦘ |