NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010052

3300010052: Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529



Overview

Basic Information
IMG/M Taxon OID3300010052 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121365 | Gp0153973 | Ga0133944
Sample NameMicrobial community associated with the xenic strain of Eucapsis sp. UTEX 1529
Sequencing StatusPermanent Draft
Sequencing CenterOregon State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size575533331
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OHSU_III1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Community Associated With The Xenic Strain Of Eucapsis Sp. Utex 1519
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid → Microbial Community Associated With The Xenic Strain Of Eucapsis Sp. Utex 1519

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUTEX collection
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002233Metagenome / Metatranscriptome580Y
F003272Metagenome / Metatranscriptome496Y
F008003Metagenome / Metatranscriptome341Y
F020707Metagenome / Metatranscriptome222Y
F023883Metagenome / Metatranscriptome208Y
F056259Metagenome / Metatranscriptome137N
F064866Metagenome / Metatranscriptome128Y
F088924Metagenome109Y
F098177Metagenome / Metatranscriptome104Y
F102772Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0133944_1000048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea559112Open in IMG/M
Ga0133944_1000097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OHSU_III393957Open in IMG/M
Ga0133944_1000293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium188692Open in IMG/M
Ga0133944_1000471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium134945Open in IMG/M
Ga0133944_1001063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales67083Open in IMG/M
Ga0133944_1001186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales60665Open in IMG/M
Ga0133944_1001835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales39768Open in IMG/M
Ga0133944_1008907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium8914Open in IMG/M
Ga0133944_1010664All Organisms → cellular organisms → Eukaryota7436Open in IMG/M
Ga0133944_1011856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris6666Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0133944_1000048Ga0133944_1000048352F064866MLVSLAFPLVAIAGTSDSQFLAQYSYPIFVMEGRQQHTGTAFFYKSGDTTFLVSNYHAIKGMSPLKQTITFSSDTLYLKYPAKETGEQKVLPINISEAHIGETEIFSMVDRIDLLKIPIAAPADADINYINELVDPAYLQATPEEVIVFGYPTDPGDIPVFYSRQQRLQGKVNPNGFTEYDASLRINFPGTSDSARAIVGSTARYYYFIKPYAAQGYSGAPVFGRFRTADNKIIYRFTGVIFAGQPTTRQTWAIKGSVALQYLKGEL*
Ga0133944_1000097Ga0133944_1000097193F002233MRQVQSLLRNAPARIGRRLAQIVAIAAASLPQAGA*
Ga0133944_1000214Ga0133944_100021482F088924MTHPCVTTTLRFAWALLVLASVHPGIAADPLTLLFAGSSSTYWNDMPREVAKLVSGKVVSSPGTAVTPAIVGRSGSDIRVYLEPDFARYEYGVKPGQSFLEKVAAERPRYVVLQVVARFITDDDPNKTGNAHAAAVTKYCEAIRASGGEPVFYEMGWGKSEREGLARILTLAKENRIKFFAPCASAWARVYTDKPDLALQHPKDGSHPGDAGHFLNLACFYAALTRESPVGKLPRSFPVWPHAVGKSETAEARAADEARLAKFQPNAYQAGLPKWMHRLMAYQAQATLDEKTAQYLETVAWETWQAKDKELQSVLKQD*
Ga0133944_1000293Ga0133944_100029319F020707MCLIHGDFKHFAASKANHFRLQGKNSSIMYAKLLSIMRAETGLVTSG*
Ga0133944_1000471Ga0133944_100047116F003272MIRARHAVLAAAMLMTMGTSVAAEVLDATYRGTMVCDKLPFTSDKMREAIEVTITGGAARYSHVVRLRNVAVEPTAEEGTGKIDGQKIDLQGTWKSGGREYQAKYSGSFVRRSARLKGTQTWTDDGKTVTRACAGAIKRPFKPFLPRARKQAAAGQEIATRSLN*
Ga0133944_1001063Ga0133944_10010638F023883MPPAPKRKPADDPTAPDPDKNARLETYEQEVERASVDSIAEHPDGSAPPLERLVDAHPEKQRKPLP*
Ga0133944_1001186Ga0133944_100118645F098177MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK*
Ga0133944_1001835Ga0133944_100183537F008003MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML*
Ga0133944_1008907Ga0133944_10089075F102772MLVVPLAAGIHLFLQCDARAQAADALPAAAEPWLAEPGDWAADFNEAQVACYEGSMTACDSIWMNDRVLFDTFLGDYGRSCGGRVDIREIRRANLTCAEAFPGYE*
Ga0133944_1010664Ga0133944_10106649F056259LIPASAANPKNMDDDADDDMDSKIDQCIRDVWAYYDKKNKGFLTKGEAETFFKDALNIMCLRKGVKAKDILPPGVSEGKAISQSFQKLDKNGTGKIDFNAFEEFINMSDLDEALSLFTGQQGPISVATDKVKLVDTSQFAAGAKANAANIQYRDYPDD*
Ga0133944_1011856Ga0133944_10118562F102772MSNNASRLWAIPLAASACLFFEAGLVAQTADELPNAQEPLLAEPDDWAADFNEAQLACFQGSMRACDSIRLNERILLDSFLAQYGRTCGGRVDLREIRRANLNCTEAFPGHD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.