


| Basic Information | |
|---|---|
| Family ID | F002233 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 580 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MRQVRSLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Number of Associated Samples | 433 |
| Number of Associated Scaffolds | 580 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.97 % |
| % of genes near scaffold ends (potentially truncated) | 23.28 % |
| % of genes from short scaffolds (< 2000 bps) | 79.14 % |
| Associated GOLD sequencing projects | 387 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.310 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.069 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.21% β-sheet: 0.00% Coil/Unstructured: 50.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 580 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 11.72 |
| PF13561 | adh_short_C2 | 10.00 |
| PF00202 | Aminotran_3 | 9.31 |
| PF01494 | FAD_binding_3 | 6.21 |
| PF07729 | FCD | 5.17 |
| PF00850 | Hist_deacetyl | 2.41 |
| PF02776 | TPP_enzyme_N | 2.24 |
| PF00392 | GntR | 2.07 |
| PF03401 | TctC | 1.90 |
| PF00920 | ILVD_EDD | 1.72 |
| PF00106 | adh_short | 1.38 |
| PF08545 | ACP_syn_III | 1.21 |
| PF02775 | TPP_enzyme_C | 1.03 |
| PF04909 | Amidohydro_2 | 1.03 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF01207 | Dus | 0.69 |
| PF10908 | DUF2778 | 0.69 |
| PF13467 | RHH_4 | 0.69 |
| PF01810 | LysE | 0.69 |
| PF00389 | 2-Hacid_dh | 0.69 |
| PF01636 | APH | 0.52 |
| PF02518 | HATPase_c | 0.52 |
| PF00561 | Abhydrolase_1 | 0.52 |
| PF00072 | Response_reg | 0.52 |
| PF05222 | AlaDh_PNT_N | 0.52 |
| PF00440 | TetR_N | 0.52 |
| PF03069 | FmdA_AmdA | 0.52 |
| PF12802 | MarR_2 | 0.52 |
| PF01262 | AlaDh_PNT_C | 0.34 |
| PF07702 | UTRA | 0.34 |
| PF04095 | NAPRTase | 0.34 |
| PF02129 | Peptidase_S15 | 0.34 |
| PF07883 | Cupin_2 | 0.34 |
| PF12833 | HTH_18 | 0.34 |
| PF08521 | 2CSK_N | 0.34 |
| PF12847 | Methyltransf_18 | 0.17 |
| PF02627 | CMD | 0.17 |
| PF00501 | AMP-binding | 0.17 |
| PF00196 | GerE | 0.17 |
| PF13412 | HTH_24 | 0.17 |
| PF00108 | Thiolase_N | 0.17 |
| PF02771 | Acyl-CoA_dh_N | 0.17 |
| PF08327 | AHSA1 | 0.17 |
| PF00005 | ABC_tran | 0.17 |
| PF00144 | Beta-lactamase | 0.17 |
| PF03972 | MmgE_PrpD | 0.17 |
| PF13417 | GST_N_3 | 0.17 |
| PF13193 | AMP-binding_C | 0.17 |
| PF01527 | HTH_Tnp_1 | 0.17 |
| PF01557 | FAA_hydrolase | 0.17 |
| PF00912 | Transgly | 0.17 |
| PF08223 | PaaX_C | 0.17 |
| PF01037 | AsnC_trans_reg | 0.17 |
| PF04055 | Radical_SAM | 0.17 |
| PF03737 | RraA-like | 0.17 |
| PF10531 | SLBB | 0.17 |
| PF13975 | gag-asp_proteas | 0.17 |
| PF03958 | Secretin_N | 0.17 |
| PF14207 | DpnD-PcfM | 0.17 |
| PF11749 | DUF3305 | 0.17 |
| PF13683 | rve_3 | 0.17 |
| PF11706 | zf-CGNR | 0.17 |
| PF13601 | HTH_34 | 0.17 |
| PF02653 | BPD_transp_2 | 0.17 |
| PF02515 | CoA_transf_3 | 0.17 |
| PF07559 | FlaE | 0.17 |
| PF13458 | Peripla_BP_6 | 0.17 |
| PF06968 | BATS | 0.17 |
| PF02922 | CBM_48 | 0.17 |
| PF00486 | Trans_reg_C | 0.17 |
| PF02277 | DBI_PRT | 0.17 |
| PF13187 | Fer4_9 | 0.17 |
| PF07690 | MFS_1 | 0.17 |
| PF07685 | GATase_3 | 0.17 |
| PF00581 | Rhodanese | 0.17 |
| PF10609 | ParA | 0.17 |
| PF01042 | Ribonuc_L-PSP | 0.17 |
| PF00892 | EamA | 0.17 |
| PF03060 | NMO | 0.17 |
| PF09084 | NMT1 | 0.17 |
| PF13744 | HTH_37 | 0.17 |
| PF13751 | DDE_Tnp_1_6 | 0.17 |
| PF00590 | TP_methylase | 0.17 |
| COG ID | Name | Functional Category | % Frequency in 580 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 12.41 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 6.21 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 6.21 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 6.21 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 5.17 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 5.17 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.83 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 3.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.90 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.52 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.34 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.34 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.17 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.17 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.17 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.17 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.17 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.17 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.17 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.17 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.17 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.17 |
| COG2038 | NaMN:DMB phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.17 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.17 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.17 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.17 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.17 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.17 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.17 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.86 % |
| Unclassified | root | N/A | 4.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402F47A0 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 2199352025|deepsgr__Contig_149513 | Not Available | 548 | Open in IMG/M |
| 2228664021|ICCgaii200_c0936942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2669 | Open in IMG/M |
| 3300000787|JGI11643J11755_11438034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 532 | Open in IMG/M |
| 3300000955|JGI1027J12803_101467317 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300000956|JGI10216J12902_105377063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1448 | Open in IMG/M |
| 3300000956|JGI10216J12902_106431497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 979 | Open in IMG/M |
| 3300001086|JGI12709J13192_1018141 | Not Available | 545 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108635752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 552 | Open in IMG/M |
| 3300001593|JGI12635J15846_10021237 | All Organisms → cellular organisms → Bacteria | 5327 | Open in IMG/M |
| 3300001661|JGI12053J15887_10006166 | Not Available | 6369 | Open in IMG/M |
| 3300001661|JGI12053J15887_10013535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 4502 | Open in IMG/M |
| 3300001661|JGI12053J15887_10090821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 1666 | Open in IMG/M |
| 3300001661|JGI12053J15887_10211855 | Not Available | 979 | Open in IMG/M |
| 3300001867|JGI12627J18819_10050961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1728 | Open in IMG/M |
| 3300002184|JGI24770J26754_10045376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1981 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100041415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4151 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100577760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1001 | Open in IMG/M |
| 3300002568|C688J35102_120233097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 940 | Open in IMG/M |
| 3300002568|C688J35102_120863364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
| 3300003203|JGI25406J46586_10191734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 596 | Open in IMG/M |
| 3300003215|JGI25153J46596_10021657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2390 | Open in IMG/M |
| 3300003659|JGI25404J52841_10042585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 961 | Open in IMG/M |
| 3300004153|Ga0063455_101241178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 563 | Open in IMG/M |
| 3300004153|Ga0063455_101484622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300004479|Ga0062595_102514306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 514 | Open in IMG/M |
| 3300005093|Ga0062594_100809815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 868 | Open in IMG/M |
| 3300005093|Ga0062594_101293787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 731 | Open in IMG/M |
| 3300005172|Ga0066683_10052005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2418 | Open in IMG/M |
| 3300005172|Ga0066683_10915914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 501 | Open in IMG/M |
| 3300005208|Ga0069003_10076738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 610 | Open in IMG/M |
| 3300005328|Ga0070676_10322630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1054 | Open in IMG/M |
| 3300005331|Ga0070670_100475847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1109 | Open in IMG/M |
| 3300005334|Ga0068869_100255691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1401 | Open in IMG/M |
| 3300005334|Ga0068869_102085939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 509 | Open in IMG/M |
| 3300005338|Ga0068868_100958149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 781 | Open in IMG/M |
| 3300005344|Ga0070661_100922377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 722 | Open in IMG/M |
| 3300005355|Ga0070671_101592793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300005367|Ga0070667_100891245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 828 | Open in IMG/M |
| 3300005435|Ga0070714_100303207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1490 | Open in IMG/M |
| 3300005444|Ga0070694_101712492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005455|Ga0070663_100049188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2992 | Open in IMG/M |
| 3300005455|Ga0070663_101117024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
| 3300005456|Ga0070678_101106936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 731 | Open in IMG/M |
| 3300005456|Ga0070678_101648544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 603 | Open in IMG/M |
| 3300005511|Ga0077121_10218515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1503 | Open in IMG/M |
| 3300005511|Ga0077121_10295754 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005513|Ga0077120_1026043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 4197 | Open in IMG/M |
| 3300005529|Ga0070741_10001209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 81402 | Open in IMG/M |
| 3300005533|Ga0070734_10385493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 800 | Open in IMG/M |
| 3300005537|Ga0070730_10161840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1512 | Open in IMG/M |
| 3300005539|Ga0068853_102255073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300005541|Ga0070733_10000355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 38415 | Open in IMG/M |
| 3300005543|Ga0070672_100365649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1232 | Open in IMG/M |
| 3300005543|Ga0070672_101107769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300005544|Ga0070686_100201567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1427 | Open in IMG/M |
| 3300005548|Ga0070665_100357380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1466 | Open in IMG/M |
| 3300005548|Ga0070665_100984373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 856 | Open in IMG/M |
| 3300005548|Ga0070665_101038456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 832 | Open in IMG/M |
| 3300005548|Ga0070665_101083641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
| 3300005548|Ga0070665_101939380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 595 | Open in IMG/M |
| 3300005552|Ga0066701_10247185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300005556|Ga0066707_10530087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 762 | Open in IMG/M |
| 3300005556|Ga0066707_10580919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 718 | Open in IMG/M |
| 3300005557|Ga0066704_10202076 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300005557|Ga0066704_10289957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300005560|Ga0066670_10029300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2671 | Open in IMG/M |
| 3300005563|Ga0068855_100107003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 3213 | Open in IMG/M |
| 3300005563|Ga0068855_100479934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1353 | Open in IMG/M |
| 3300005564|Ga0070664_101735755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 592 | Open in IMG/M |
| 3300005568|Ga0066703_10429103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 793 | Open in IMG/M |
| 3300005574|Ga0066694_10072154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1591 | Open in IMG/M |
| 3300005577|Ga0068857_100062557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3309 | Open in IMG/M |
| 3300005586|Ga0066691_10568997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 675 | Open in IMG/M |
| 3300005598|Ga0066706_11515260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300005602|Ga0070762_10012244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4339 | Open in IMG/M |
| 3300005602|Ga0070762_10405719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300005602|Ga0070762_10640814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 709 | Open in IMG/M |
| 3300005610|Ga0070763_10972881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300005617|Ga0068859_100413868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1444 | Open in IMG/M |
| 3300005617|Ga0068859_101356506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 784 | Open in IMG/M |
| 3300005660|Ga0073904_10170705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1282 | Open in IMG/M |
| 3300005712|Ga0070764_11028242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300005718|Ga0068866_10398399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 887 | Open in IMG/M |
| 3300005834|Ga0068851_10210276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1089 | Open in IMG/M |
| 3300005840|Ga0068870_11172370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 555 | Open in IMG/M |
| 3300005841|Ga0068863_100177100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2047 | Open in IMG/M |
| 3300005842|Ga0068858_100124705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2410 | Open in IMG/M |
| 3300005842|Ga0068858_100127112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2388 | Open in IMG/M |
| 3300005842|Ga0068858_101175820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 754 | Open in IMG/M |
| 3300005844|Ga0068862_102266758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 555 | Open in IMG/M |
| 3300005921|Ga0070766_10326743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 991 | Open in IMG/M |
| 3300005937|Ga0081455_10494673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 823 | Open in IMG/M |
| 3300005983|Ga0081540_1001252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 22193 | Open in IMG/M |
| 3300005983|Ga0081540_1021494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3839 | Open in IMG/M |
| 3300005985|Ga0081539_10453425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300005994|Ga0066789_10095752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300005994|Ga0066789_10239111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 762 | Open in IMG/M |
| 3300006028|Ga0070717_10006323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8705 | Open in IMG/M |
| 3300006028|Ga0070717_11770150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 559 | Open in IMG/M |
| 3300006031|Ga0066651_10750698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
| 3300006038|Ga0075365_10058742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2561 | Open in IMG/M |
| 3300006038|Ga0075365_10340729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1056 | Open in IMG/M |
| 3300006038|Ga0075365_10966076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
| 3300006038|Ga0075365_11053988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300006042|Ga0075368_10190577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 866 | Open in IMG/M |
| 3300006042|Ga0075368_10322953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300006048|Ga0075363_100256686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1007 | Open in IMG/M |
| 3300006050|Ga0075028_100577480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 665 | Open in IMG/M |
| 3300006051|Ga0075364_11021874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300006055|Ga0097691_1015051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3586 | Open in IMG/M |
| 3300006057|Ga0075026_100112113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1365 | Open in IMG/M |
| 3300006057|Ga0075026_100599861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 647 | Open in IMG/M |
| 3300006057|Ga0075026_100630476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300006059|Ga0075017_100148099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1669 | Open in IMG/M |
| 3300006059|Ga0075017_100501964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
| 3300006086|Ga0075019_10021614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3597 | Open in IMG/M |
| 3300006102|Ga0075015_100011386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3758 | Open in IMG/M |
| 3300006102|Ga0075015_100869493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300006163|Ga0070715_10297484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 862 | Open in IMG/M |
| 3300006172|Ga0075018_10147887 | Not Available | 1081 | Open in IMG/M |
| 3300006174|Ga0075014_100552713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 652 | Open in IMG/M |
| 3300006178|Ga0075367_10381550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 890 | Open in IMG/M |
| 3300006178|Ga0075367_11016609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300006186|Ga0075369_10370199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 674 | Open in IMG/M |
| 3300006195|Ga0075366_10898510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006237|Ga0097621_101503775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
| 3300006352|Ga0075448_10000042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 40466 | Open in IMG/M |
| 3300006354|Ga0075021_10349718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300006577|Ga0074050_11137217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 576 | Open in IMG/M |
| 3300006578|Ga0074059_11613598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 726 | Open in IMG/M |
| 3300006606|Ga0074062_12176176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 568 | Open in IMG/M |
| 3300006791|Ga0066653_10542303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 588 | Open in IMG/M |
| 3300006797|Ga0066659_10308471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300006800|Ga0066660_10236633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1419 | Open in IMG/M |
| 3300006864|Ga0066797_1091667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1064 | Open in IMG/M |
| 3300006881|Ga0068865_100446228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1069 | Open in IMG/M |
| 3300006881|Ga0068865_101681945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
| 3300006893|Ga0073928_10047215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3919 | Open in IMG/M |
| 3300006904|Ga0075424_100629509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1146 | Open in IMG/M |
| 3300006941|Ga0099825_1034008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1930 | Open in IMG/M |
| 3300006950|Ga0075524_10289994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 717 | Open in IMG/M |
| 3300006954|Ga0079219_10187412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1156 | Open in IMG/M |
| 3300007788|Ga0099795_10183977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 874 | Open in IMG/M |
| 3300007788|Ga0099795_10216516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 814 | Open in IMG/M |
| 3300009011|Ga0105251_10644265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300009012|Ga0066710_104611117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300009078|Ga0105106_10823742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 661 | Open in IMG/M |
| 3300009098|Ga0105245_10259868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1690 | Open in IMG/M |
| 3300009098|Ga0105245_12582526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 561 | Open in IMG/M |
| 3300009100|Ga0075418_10121847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2771 | Open in IMG/M |
| 3300009101|Ga0105247_10919759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 677 | Open in IMG/M |
| 3300009111|Ga0115026_11937092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 503 | Open in IMG/M |
| 3300009112|Ga0115923_10879296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300009137|Ga0066709_103642164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300009143|Ga0099792_10418372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
| 3300009143|Ga0099792_10441216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300009162|Ga0075423_11227028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 800 | Open in IMG/M |
| 3300009174|Ga0105241_11492359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 650 | Open in IMG/M |
| 3300009176|Ga0105242_11514122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
| 3300009177|Ga0105248_10338153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1695 | Open in IMG/M |
| 3300009545|Ga0105237_11766845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 626 | Open in IMG/M |
| 3300009628|Ga0116125_1095888 | Not Available | 789 | Open in IMG/M |
| 3300009840|Ga0126313_10755595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 789 | Open in IMG/M |
| 3300010038|Ga0126315_10029517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2842 | Open in IMG/M |
| 3300010047|Ga0126382_11819668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 573 | Open in IMG/M |
| 3300010048|Ga0126373_11644332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 707 | Open in IMG/M |
| 3300010052|Ga0133944_1000097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OHSU_III | 393957 | Open in IMG/M |
| 3300010159|Ga0099796_10004314 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300010159|Ga0099796_10562381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 513 | Open in IMG/M |
| 3300010166|Ga0126306_11253419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2 | 610 | Open in IMG/M |
| 3300010326|Ga0134065_10227059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 687 | Open in IMG/M |
| 3300010360|Ga0126372_13236068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300010375|Ga0105239_11107048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 912 | Open in IMG/M |
| 3300010379|Ga0136449_100207032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3718 | Open in IMG/M |
| 3300010379|Ga0136449_100991663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1354 | Open in IMG/M |
| 3300010396|Ga0134126_10474738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1444 | Open in IMG/M |
| 3300010396|Ga0134126_10795970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300010397|Ga0134124_10387986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1325 | Open in IMG/M |
| 3300010397|Ga0134124_11396109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 726 | Open in IMG/M |
| 3300010864|Ga0126357_1259859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
| 3300010866|Ga0126344_1063547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 616 | Open in IMG/M |
| 3300010880|Ga0126350_10309112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300010880|Ga0126350_10389277 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300011119|Ga0105246_10966901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300011119|Ga0105246_12023210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 556 | Open in IMG/M |
| 3300011120|Ga0150983_11080026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300011120|Ga0150983_11272086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 500 | Open in IMG/M |
| 3300011269|Ga0137392_10233237 | Not Available | 1512 | Open in IMG/M |
| 3300011444|Ga0137463_1026762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2094 | Open in IMG/M |
| 3300012096|Ga0137389_11643261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300012200|Ga0137382_10366261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1012 | Open in IMG/M |
| 3300012202|Ga0137363_10054718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2876 | Open in IMG/M |
| 3300012204|Ga0137374_10607034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 833 | Open in IMG/M |
| 3300012204|Ga0137374_10959989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 622 | Open in IMG/M |
| 3300012205|Ga0137362_11177744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 650 | Open in IMG/M |
| 3300012211|Ga0137377_11576446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium embrapense | 581 | Open in IMG/M |
| 3300012211|Ga0137377_11698639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 553 | Open in IMG/M |
| 3300012212|Ga0150985_100765839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2245 | Open in IMG/M |
| 3300012212|Ga0150985_103814332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 522 | Open in IMG/M |
| 3300012212|Ga0150985_105120038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 619 | Open in IMG/M |
| 3300012351|Ga0137386_10294401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1168 | Open in IMG/M |
| 3300012355|Ga0137369_10074619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2860 | Open in IMG/M |
| 3300012357|Ga0137384_10016965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5920 | Open in IMG/M |
| 3300012359|Ga0137385_10143371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2103 | Open in IMG/M |
| 3300012359|Ga0137385_10818643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 773 | Open in IMG/M |
| 3300012361|Ga0137360_10890627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 767 | Open in IMG/M |
| 3300012469|Ga0150984_101303943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 857 | Open in IMG/M |
| 3300012469|Ga0150984_104858487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 691 | Open in IMG/M |
| 3300012469|Ga0150984_115461909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300012469|Ga0150984_122274153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 745 | Open in IMG/M |
| 3300012582|Ga0137358_10590325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 746 | Open in IMG/M |
| 3300012685|Ga0137397_10076993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2421 | Open in IMG/M |
| 3300012685|Ga0137397_10173024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 1603 | Open in IMG/M |
| 3300012892|Ga0157294_10165222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300012892|Ga0157294_10274796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 529 | Open in IMG/M |
| 3300012893|Ga0157284_10029255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1134 | Open in IMG/M |
| 3300012898|Ga0157293_10240455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 568 | Open in IMG/M |
| 3300012910|Ga0157308_10161275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas alkaliantarctica | 725 | Open in IMG/M |
| 3300012918|Ga0137396_10320539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1147 | Open in IMG/M |
| 3300012924|Ga0137413_10564534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 847 | Open in IMG/M |
| 3300012924|Ga0137413_11367560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 571 | Open in IMG/M |
| 3300012924|Ga0137413_11527510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 543 | Open in IMG/M |
| 3300012925|Ga0137419_10119083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1860 | Open in IMG/M |
| 3300012927|Ga0137416_10955794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300012927|Ga0137416_12179161 | Not Available | 509 | Open in IMG/M |
| 3300012929|Ga0137404_10022031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4611 | Open in IMG/M |
| 3300012929|Ga0137404_10025287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4336 | Open in IMG/M |
| 3300012929|Ga0137404_10038235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 3600 | Open in IMG/M |
| 3300012930|Ga0137407_11776131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 588 | Open in IMG/M |
| 3300012931|Ga0153915_10736900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1140 | Open in IMG/M |
| 3300012931|Ga0153915_11874472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 702 | Open in IMG/M |
| 3300012937|Ga0162653_100069646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus → Inquilinus limosus MP06 | 566 | Open in IMG/M |
| 3300012944|Ga0137410_10115475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2009 | Open in IMG/M |
| 3300012944|Ga0137410_10679385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 857 | Open in IMG/M |
| 3300012951|Ga0164300_10106392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1241 | Open in IMG/M |
| 3300012958|Ga0164299_11236514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 567 | Open in IMG/M |
| 3300012971|Ga0126369_10622151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1152 | Open in IMG/M |
| 3300012981|Ga0168316_101314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 8321 | Open in IMG/M |
| 3300012985|Ga0164308_10690783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300012986|Ga0164304_10553096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 850 | Open in IMG/M |
| 3300012987|Ga0164307_11385468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
| 3300012988|Ga0164306_12002114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 504 | Open in IMG/M |
| 3300013105|Ga0157369_10287607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1711 | Open in IMG/M |
| 3300013297|Ga0157378_12388925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 580 | Open in IMG/M |
| 3300013306|Ga0163162_12568276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 586 | Open in IMG/M |
| 3300013772|Ga0120158_10511426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 526 | Open in IMG/M |
| 3300014167|Ga0181528_10051720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2276 | Open in IMG/M |
| 3300014167|Ga0181528_10558099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 632 | Open in IMG/M |
| 3300014169|Ga0181531_10114243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1620 | Open in IMG/M |
| 3300014301|Ga0075323_1013915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1356 | Open in IMG/M |
| 3300014326|Ga0157380_10022609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 4739 | Open in IMG/M |
| 3300014326|Ga0157380_10240967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1630 | Open in IMG/M |
| 3300014490|Ga0182010_10067898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1733 | Open in IMG/M |
| 3300014492|Ga0182013_10224932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1106 | Open in IMG/M |
| 3300014492|Ga0182013_10321632 | Not Available | 859 | Open in IMG/M |
| 3300014495|Ga0182015_10662834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 659 | Open in IMG/M |
| 3300014501|Ga0182024_10647359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1314 | Open in IMG/M |
| 3300014501|Ga0182024_11846964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 674 | Open in IMG/M |
| 3300014654|Ga0181525_10214517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1050 | Open in IMG/M |
| 3300014654|Ga0181525_10383896 | Not Available | 771 | Open in IMG/M |
| 3300014654|Ga0181525_10418295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
| 3300014657|Ga0181522_11052514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 505 | Open in IMG/M |
| 3300014745|Ga0157377_10041612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2550 | Open in IMG/M |
| 3300014969|Ga0157376_12284258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300015051|Ga0137414_1198020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1728 | Open in IMG/M |
| 3300015077|Ga0173483_10651149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
| 3300015077|Ga0173483_10860451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300015089|Ga0167643_1000637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4083 | Open in IMG/M |
| 3300015200|Ga0173480_10142975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1213 | Open in IMG/M |
| 3300015200|Ga0173480_10723806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300015200|Ga0173480_10837067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 591 | Open in IMG/M |
| 3300015200|Ga0173480_11055984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 539 | Open in IMG/M |
| 3300015206|Ga0167644_1000295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 53123 | Open in IMG/M |
| 3300015206|Ga0167644_1087400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 965 | Open in IMG/M |
| 3300015206|Ga0167644_1092245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 923 | Open in IMG/M |
| 3300015245|Ga0137409_10938408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
| 3300015264|Ga0137403_10433862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1191 | Open in IMG/M |
| 3300015371|Ga0132258_13704055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1043 | Open in IMG/M |
| 3300015374|Ga0132255_106025538 | Not Available | 513 | Open in IMG/M |
| 3300016270|Ga0182036_10019645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3821 | Open in IMG/M |
| 3300017792|Ga0163161_11444690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
| 3300017792|Ga0163161_11462770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300017948|Ga0187847_10086640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1735 | Open in IMG/M |
| 3300017965|Ga0190266_10990128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300018000|Ga0184604_10128850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 815 | Open in IMG/M |
| 3300018027|Ga0184605_10171641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 980 | Open in IMG/M |
| 3300018027|Ga0184605_10518722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 517 | Open in IMG/M |
| 3300018028|Ga0184608_10140213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
| 3300018043|Ga0187887_10135811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1475 | Open in IMG/M |
| 3300018054|Ga0184621_10203241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 710 | Open in IMG/M |
| 3300018055|Ga0184616_10331270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 575 | Open in IMG/M |
| 3300018064|Ga0187773_10007322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4537 | Open in IMG/M |
| 3300018081|Ga0184625_10484971 | Not Available | 627 | Open in IMG/M |
| 3300018412|Ga0194136_1000739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 16483 | Open in IMG/M |
| 3300018429|Ga0190272_10300249 | Not Available | 1244 | Open in IMG/M |
| 3300018429|Ga0190272_10805072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus → Inquilinus limosus MP06 | 866 | Open in IMG/M |
| 3300018429|Ga0190272_12934752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 528 | Open in IMG/M |
| 3300018431|Ga0066655_10320445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1012 | Open in IMG/M |
| 3300018431|Ga0066655_10878403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 612 | Open in IMG/M |
| 3300018432|Ga0190275_12981296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 547 | Open in IMG/M |
| 3300018466|Ga0190268_10607951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 777 | Open in IMG/M |
| 3300018466|Ga0190268_12068145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 527 | Open in IMG/M |
| 3300018468|Ga0066662_10220973 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300018468|Ga0066662_10767870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300018468|Ga0066662_11085942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 799 | Open in IMG/M |
| 3300018468|Ga0066662_12560329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300018469|Ga0190270_10671189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 1023 | Open in IMG/M |
| 3300018476|Ga0190274_12074055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 665 | Open in IMG/M |
| 3300018476|Ga0190274_13056132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300018481|Ga0190271_11306991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 845 | Open in IMG/M |
| 3300018482|Ga0066669_10454221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 1100 | Open in IMG/M |
| 3300018482|Ga0066669_11274531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 664 | Open in IMG/M |
| 3300018920|Ga0190273_10035398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2401 | Open in IMG/M |
| 3300019377|Ga0190264_11041357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 659 | Open in IMG/M |
| 3300019789|Ga0137408_1179068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6603 | Open in IMG/M |
| 3300019883|Ga0193725_1000981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 8169 | Open in IMG/M |
| 3300019887|Ga0193729_1157872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
| 3300019887|Ga0193729_1189550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 711 | Open in IMG/M |
| 3300019889|Ga0193743_1038449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2203 | Open in IMG/M |
| 3300020060|Ga0193717_1012457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3979 | Open in IMG/M |
| 3300020199|Ga0179592_10007139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4772 | Open in IMG/M |
| 3300020579|Ga0210407_10048372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3172 | Open in IMG/M |
| 3300020579|Ga0210407_10122686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300020579|Ga0210407_10159601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1741 | Open in IMG/M |
| 3300020582|Ga0210395_10530692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 885 | Open in IMG/M |
| 3300020583|Ga0210401_10006269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12117 | Open in IMG/M |
| 3300020583|Ga0210401_10096885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2772 | Open in IMG/M |
| 3300021080|Ga0210382_10464345 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021082|Ga0210380_10016158 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300021082|Ga0210380_10300943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas alkaliantarctica | 730 | Open in IMG/M |
| 3300021088|Ga0210404_10003260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 6597 | Open in IMG/M |
| 3300021088|Ga0210404_10026001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2573 | Open in IMG/M |
| 3300021168|Ga0210406_10100918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2453 | Open in IMG/M |
| 3300021168|Ga0210406_10437778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 1042 | Open in IMG/M |
| 3300021170|Ga0210400_10201124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1619 | Open in IMG/M |
| 3300021170|Ga0210400_11103308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
| 3300021170|Ga0210400_11127647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 634 | Open in IMG/M |
| 3300021178|Ga0210408_10000717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 38481 | Open in IMG/M |
| 3300021180|Ga0210396_10004665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13370 | Open in IMG/M |
| 3300021180|Ga0210396_10434010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1153 | Open in IMG/M |
| 3300021344|Ga0193719_10145442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1024 | Open in IMG/M |
| 3300021361|Ga0213872_10331971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300021363|Ga0193699_10069437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1390 | Open in IMG/M |
| 3300021363|Ga0193699_10174261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 889 | Open in IMG/M |
| 3300021402|Ga0210385_11117439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300021404|Ga0210389_10018024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5459 | Open in IMG/M |
| 3300021404|Ga0210389_10531877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 925 | Open in IMG/M |
| 3300021404|Ga0210389_10570353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 890 | Open in IMG/M |
| 3300021405|Ga0210387_10601790 | Not Available | 977 | Open in IMG/M |
| 3300021406|Ga0210386_10378454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1219 | Open in IMG/M |
| 3300021411|Ga0193709_1010597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2290 | Open in IMG/M |
| 3300021432|Ga0210384_10053201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 3669 | Open in IMG/M |
| 3300021432|Ga0210384_10759922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 866 | Open in IMG/M |
| 3300021433|Ga0210391_10152195 | Not Available | 1821 | Open in IMG/M |
| 3300021477|Ga0210398_10015459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 6621 | Open in IMG/M |
| 3300021478|Ga0210402_10353440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1364 | Open in IMG/M |
| 3300021479|Ga0210410_10274421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1513 | Open in IMG/M |
| 3300021479|Ga0210410_11598093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 545 | Open in IMG/M |
| 3300021559|Ga0210409_10054827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3737 | Open in IMG/M |
| 3300021858|Ga0213852_1448470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 839 | Open in IMG/M |
| 3300021860|Ga0213851_1392789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1020 | Open in IMG/M |
| 3300021861|Ga0213853_10035250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 747 | Open in IMG/M |
| 3300021976|Ga0193742_1016556 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
| 3300022506|Ga0242648_1013861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 953 | Open in IMG/M |
| 3300022506|Ga0242648_1061280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 593 | Open in IMG/M |
| 3300022507|Ga0222729_1049940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 577 | Open in IMG/M |
| 3300022532|Ga0242655_10137965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 704 | Open in IMG/M |
| 3300022533|Ga0242662_10224944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
| 3300022533|Ga0242662_10235298 | Not Available | 589 | Open in IMG/M |
| 3300022533|Ga0242662_10270421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300022557|Ga0212123_10846283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300022561|Ga0212090_10018310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 9018 | Open in IMG/M |
| 3300022721|Ga0242666_1146178 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300022726|Ga0242654_10290182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300022756|Ga0222622_10100434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1778 | Open in IMG/M |
| 3300022756|Ga0222622_10219193 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300022756|Ga0222622_10257498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1185 | Open in IMG/M |
| 3300022756|Ga0222622_11097935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
| 3300022756|Ga0222622_11215075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 555 | Open in IMG/M |
| 3300022894|Ga0247778_1034362 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300022894|Ga0247778_1163013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 616 | Open in IMG/M |
| 3300024347|Ga0179591_1036912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2858 | Open in IMG/M |
| 3300025261|Ga0209233_1022744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1599 | Open in IMG/M |
| 3300025297|Ga0209758_1004351 | All Organisms → cellular organisms → Bacteria | 11863 | Open in IMG/M |
| 3300025297|Ga0209758_1045085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1604 | Open in IMG/M |
| 3300025321|Ga0207656_10331747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 757 | Open in IMG/M |
| 3300025481|Ga0208079_1045416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1042 | Open in IMG/M |
| 3300025509|Ga0208848_1105412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 565 | Open in IMG/M |
| 3300025527|Ga0208714_1006476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3145 | Open in IMG/M |
| 3300025553|Ga0208080_1060917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 914 | Open in IMG/M |
| 3300025619|Ga0207926_1015564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2481 | Open in IMG/M |
| 3300025899|Ga0207642_10141436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1269 | Open in IMG/M |
| 3300025900|Ga0207710_10329110 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300025901|Ga0207688_10057317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2190 | Open in IMG/M |
| 3300025903|Ga0207680_11106130 | Not Available | 566 | Open in IMG/M |
| 3300025904|Ga0207647_10096998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1754 | Open in IMG/M |
| 3300025905|Ga0207685_10707406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300025907|Ga0207645_10115648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1739 | Open in IMG/M |
| 3300025909|Ga0207705_11193818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 584 | Open in IMG/M |
| 3300025914|Ga0207671_10791320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 752 | Open in IMG/M |
| 3300025914|Ga0207671_11269006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 574 | Open in IMG/M |
| 3300025915|Ga0207693_10237959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1429 | Open in IMG/M |
| 3300025918|Ga0207662_10200513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1291 | Open in IMG/M |
| 3300025919|Ga0207657_10221657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1515 | Open in IMG/M |
| 3300025920|Ga0207649_10793895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 739 | Open in IMG/M |
| 3300025925|Ga0207650_11294842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300025927|Ga0207687_10051666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2866 | Open in IMG/M |
| 3300025931|Ga0207644_10727966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 828 | Open in IMG/M |
| 3300025931|Ga0207644_11019860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 695 | Open in IMG/M |
| 3300025932|Ga0207690_10502778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 980 | Open in IMG/M |
| 3300025932|Ga0207690_11358084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300025933|Ga0207706_10129180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 2222 | Open in IMG/M |
| 3300025935|Ga0207709_10082944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2071 | Open in IMG/M |
| 3300025939|Ga0207665_10568061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 883 | Open in IMG/M |
| 3300025940|Ga0207691_10401951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1168 | Open in IMG/M |
| 3300025941|Ga0207711_10511019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1120 | Open in IMG/M |
| 3300025945|Ga0207679_10440250 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300025949|Ga0207667_11792165 | Not Available | 578 | Open in IMG/M |
| 3300025972|Ga0207668_12016781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300025972|Ga0207668_12050616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300025986|Ga0207658_11886995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300026067|Ga0207678_10399168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300026078|Ga0207702_11877220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 590 | Open in IMG/M |
| 3300026088|Ga0207641_10186577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1903 | Open in IMG/M |
| 3300026089|Ga0207648_10033803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4508 | Open in IMG/M |
| 3300026095|Ga0207676_11497085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300026121|Ga0207683_11041350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300026121|Ga0207683_11798503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300026214|Ga0209838_1006965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1567 | Open in IMG/M |
| 3300026227|Ga0209763_113162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 521 | Open in IMG/M |
| 3300026273|Ga0209881_1117196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 664 | Open in IMG/M |
| 3300026285|Ga0209438_1022150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2121 | Open in IMG/M |
| 3300026291|Ga0209890_10094727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300026312|Ga0209153_1000368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 22196 | Open in IMG/M |
| 3300026318|Ga0209471_1114579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1153 | Open in IMG/M |
| 3300026319|Ga0209647_1350715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 500 | Open in IMG/M |
| 3300026329|Ga0209375_1241622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| 3300026538|Ga0209056_10214818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1395 | Open in IMG/M |
| 3300026555|Ga0179593_1154589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2906 | Open in IMG/M |
| 3300026557|Ga0179587_10202513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1258 | Open in IMG/M |
| 3300026557|Ga0179587_10599311 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300026557|Ga0179587_10703175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 666 | Open in IMG/M |
| 3300026557|Ga0179587_10874225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 593 | Open in IMG/M |
| 3300026721|Ga0208841_104823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
| 3300026897|Ga0209906_109877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1304 | Open in IMG/M |
| 3300027096|Ga0208099_1011942 | Not Available | 1163 | Open in IMG/M |
| 3300027257|Ga0208996_1071229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 518 | Open in IMG/M |
| 3300027257|Ga0208996_1072437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 514 | Open in IMG/M |
| 3300027313|Ga0207780_1009721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2060 | Open in IMG/M |
| 3300027357|Ga0209589_1000001 | All Organisms → cellular organisms → Bacteria | 794224 | Open in IMG/M |
| 3300027383|Ga0209213_1000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 29585 | Open in IMG/M |
| 3300027388|Ga0208995_1019693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1166 | Open in IMG/M |
| 3300027480|Ga0208993_1000292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6754 | Open in IMG/M |
| 3300027562|Ga0209735_1130672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 547 | Open in IMG/M |
| 3300027587|Ga0209220_1011459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2364 | Open in IMG/M |
| 3300027603|Ga0209331_1002106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6138 | Open in IMG/M |
| 3300027616|Ga0209106_1000470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5984 | Open in IMG/M |
| 3300027651|Ga0209217_1014959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2522 | Open in IMG/M |
| 3300027669|Ga0208981_1012348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2163 | Open in IMG/M |
| 3300027669|Ga0208981_1038454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 1222 | Open in IMG/M |
| 3300027671|Ga0209588_1276225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 509 | Open in IMG/M |
| 3300027678|Ga0209011_1004177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5022 | Open in IMG/M |
| 3300027681|Ga0208991_1060400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1144 | Open in IMG/M |
| 3300027684|Ga0209626_1007645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2443 | Open in IMG/M |
| 3300027684|Ga0209626_1008095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2379 | Open in IMG/M |
| 3300027716|Ga0209682_10004127 | All Organisms → cellular organisms → Bacteria | 3981 | Open in IMG/M |
| 3300027738|Ga0208989_10247584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 581 | Open in IMG/M |
| 3300027802|Ga0209476_10178685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 981 | Open in IMG/M |
| 3300027817|Ga0209112_10211256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300027819|Ga0209514_10058685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2583 | Open in IMG/M |
| 3300027866|Ga0209813_10230516 | Not Available | 697 | Open in IMG/M |
| 3300027867|Ga0209167_10000454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 30282 | Open in IMG/M |
| 3300027870|Ga0209023_10005176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 14401 | Open in IMG/M |
| 3300027894|Ga0209068_10142233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1293 | Open in IMG/M |
| 3300027894|Ga0209068_10586974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300027895|Ga0209624_10566721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300027898|Ga0209067_10013824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4205 | Open in IMG/M |
| 3300027902|Ga0209048_10049107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3455 | Open in IMG/M |
| 3300027903|Ga0209488_10880907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 629 | Open in IMG/M |
| 3300027907|Ga0207428_10347984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1091 | Open in IMG/M |
| 3300027908|Ga0209006_10009267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8880 | Open in IMG/M |
| 3300027908|Ga0209006_10455782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1071 | Open in IMG/M |
| 3300027915|Ga0209069_10243834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 932 | Open in IMG/M |
| 3300028047|Ga0209526_10059770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2683 | Open in IMG/M |
| 3300028047|Ga0209526_10212993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1334 | Open in IMG/M |
| 3300028379|Ga0268266_10422650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1263 | Open in IMG/M |
| 3300028379|Ga0268266_10715660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 965 | Open in IMG/M |
| 3300028379|Ga0268266_12081366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
| 3300028379|Ga0268266_12314941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
| 3300028380|Ga0268265_10719071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 966 | Open in IMG/M |
| 3300028380|Ga0268265_12544181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300028381|Ga0268264_10000048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 334457 | Open in IMG/M |
| 3300028381|Ga0268264_10652102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. 69 | 1042 | Open in IMG/M |
| 3300028536|Ga0137415_10210059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1763 | Open in IMG/M |
| 3300028536|Ga0137415_10675950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 845 | Open in IMG/M |
| 3300028574|Ga0302153_10083589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1080 | Open in IMG/M |
| 3300028762|Ga0302202_10307442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300028786|Ga0307517_10181523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300028786|Ga0307517_10184796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1337 | Open in IMG/M |
| 3300028796|Ga0307287_10027720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2009 | Open in IMG/M |
| 3300028811|Ga0307292_10411078 | Not Available | 576 | Open in IMG/M |
| 3300028880|Ga0307300_10018754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 1813 | Open in IMG/M |
| 3300028880|Ga0307300_10287756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300028882|Ga0302154_10037657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2842 | Open in IMG/M |
| 3300029913|Ga0311362_11207826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300029922|Ga0311363_10120610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3498 | Open in IMG/M |
| 3300029952|Ga0311346_10541156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1065 | Open in IMG/M |
| 3300029980|Ga0302298_10152100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 746 | Open in IMG/M |
| 3300029987|Ga0311334_10932014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 720 | Open in IMG/M |
| 3300029989|Ga0311365_11343265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| 3300030007|Ga0311338_10079017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4191 | Open in IMG/M |
| 3300030046|Ga0302305_1287162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 570 | Open in IMG/M |
| 3300030114|Ga0311333_10601941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 910 | Open in IMG/M |
| 3300030294|Ga0311349_10114056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2521 | Open in IMG/M |
| 3300030294|Ga0311349_10872382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 846 | Open in IMG/M |
| 3300030339|Ga0311360_10631880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 855 | Open in IMG/M |
| 3300030618|Ga0311354_11899229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300030838|Ga0311335_10075302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2138 | Open in IMG/M |
| 3300030838|Ga0311335_11200768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300030990|Ga0308178_1144155 | Not Available | 543 | Open in IMG/M |
| 3300031057|Ga0170834_106826063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 831 | Open in IMG/M |
| 3300031128|Ga0170823_10344523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300031152|Ga0307501_10019841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1263 | Open in IMG/M |
| 3300031184|Ga0307499_10000245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 20111 | Open in IMG/M |
| 3300031231|Ga0170824_109630848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 575 | Open in IMG/M |
| 3300031231|Ga0170824_123825509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
| 3300031232|Ga0302323_100533415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1263 | Open in IMG/M |
| 3300031235|Ga0265330_10239273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
| 3300031241|Ga0265325_10460398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300031250|Ga0265331_10536877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
| 3300031507|Ga0307509_10976558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 513 | Open in IMG/M |
| 3300031562|Ga0310886_10340706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 869 | Open in IMG/M |
| 3300031564|Ga0318573_10820297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 3300031616|Ga0307508_10000003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 321602 | Open in IMG/M |
| 3300031708|Ga0310686_103250397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3677 | Open in IMG/M |
| 3300031708|Ga0310686_108156235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300031708|Ga0310686_115465818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
| 3300031712|Ga0265342_10195657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1101 | Open in IMG/M |
| 3300031718|Ga0307474_10243072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1377 | Open in IMG/M |
| 3300031726|Ga0302321_103012704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300031744|Ga0306918_10238089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1385 | Open in IMG/M |
| 3300031779|Ga0318566_10487706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300031788|Ga0302319_10365190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1636 | Open in IMG/M |
| 3300031788|Ga0302319_11861214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 517 | Open in IMG/M |
| 3300031823|Ga0307478_10016246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5189 | Open in IMG/M |
| 3300031824|Ga0307413_10077898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2113 | Open in IMG/M |
| 3300031824|Ga0307413_11612101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300031852|Ga0307410_10385099 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300031854|Ga0310904_11209783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300031858|Ga0310892_10642670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 723 | Open in IMG/M |
| 3300031908|Ga0310900_11683266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300031910|Ga0306923_10422155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1516 | Open in IMG/M |
| 3300031911|Ga0307412_10664957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 890 | Open in IMG/M |
| 3300031911|Ga0307412_12247134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 508 | Open in IMG/M |
| 3300031918|Ga0311367_10379459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1459 | Open in IMG/M |
| 3300031995|Ga0307409_101095760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 817 | Open in IMG/M |
| 3300032002|Ga0307416_103436353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300032074|Ga0308173_10690492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 932 | Open in IMG/M |
| 3300032075|Ga0310890_11818821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300032126|Ga0307415_101932847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300032174|Ga0307470_10290147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1104 | Open in IMG/M |
| 3300032174|Ga0307470_10508311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 881 | Open in IMG/M |
| 3300032205|Ga0307472_100025922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3309 | Open in IMG/M |
| 3300032205|Ga0307472_100344916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1220 | Open in IMG/M |
| 3300032782|Ga0335082_10651691 | Not Available | 914 | Open in IMG/M |
| 3300032893|Ga0335069_12777064 | Not Available | 502 | Open in IMG/M |
| 3300032898|Ga0335072_10517536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1230 | Open in IMG/M |
| 3300032955|Ga0335076_10351272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1361 | Open in IMG/M |
| 3300033475|Ga0310811_10008456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13237 | Open in IMG/M |
| 3300033475|Ga0310811_10073013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4519 | Open in IMG/M |
| 3300033475|Ga0310811_10945721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
| 3300033826|Ga0334847_003185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1593 | Open in IMG/M |
| 3300034124|Ga0370483_0134633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300034126|Ga0370486_041141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
| 3300034129|Ga0370493_0288852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 561 | Open in IMG/M |
| 3300034156|Ga0370502_0095126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 946 | Open in IMG/M |
| 3300034169|Ga0370480_0161114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300034643|Ga0370545_084596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300034817|Ga0373948_0201005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 520 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.07% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.21% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.03% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.34% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.34% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.34% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.34% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.34% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.34% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.34% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.17% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.17% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.17% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.17% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.17% |
| Watersheds | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds | 0.17% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.17% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.17% |
| Liquid | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid | 0.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.17% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.17% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.17% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.17% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.17% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.17% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.17% |
| Upper Troposphere | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere | 0.17% |
| Cyanobacterial | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial | 0.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.17% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.17% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.17% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Host-Associated | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005208 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009112 | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 | Engineered | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010052 | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018412 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T3A_14 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026227 | Upper troposphere microbial communities from California, USA - DAQCA-003 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026721 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes) | Environmental | Open in IMG/M |
| 3300026897 | Cyanobacterial communities from the Joint Genome Institute, California, USA from Joint Genome Institute, California, USA - FECB-24 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027802 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes) | Engineered | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_01057150 | 2189573004 | Grass Soil | MRQLRSLWRTAPSRVRRRIAEIVAIAAASLPAAGA |
| deepsgr_02454030 | 2199352025 | Soil | MEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA |
| ICCgaii200_09369422 | 2228664021 | Soil | MRQVHTLLRGASSRIRRRLAQIVAIAAASLPTAGA |
| JGI11643J11755_114380341 | 3300000787 | Soil | MEDEEMRQVRXLLXSASSRIGRRLSQIVAIAAASLPSVGA* |
| JGI1027J12803_1014673173 | 3300000955 | Soil | MEDREMAQVRSLLRNAPSRIGRRLAQIVAIAAASLPAA |
| JGI10216J12902_1053770633 | 3300000956 | Soil | MEDEMRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| JGI10216J12902_1064314973 | 3300000956 | Soil | MRQLGSLLRAAPSRIGRRLKLIVAIAAASLPSAGA* |
| JGI12709J13192_10181412 | 3300001086 | Forest Soil | MRQLNSLLRTTRSRIGRRLALIVAIAAASLPAAGA* |
| JGIcombinedJ13530_1086357521 | 3300001213 | Wetland | MRQVGSLLRGASIRFGRRLSQIVAIAAASLPQAGA* |
| JGI12635J15846_100212373 | 3300001593 | Forest Soil | MRKVTSLLRAVPSRIGRRLALIVAIAAASLPAAGA* |
| JGI12053J15887_100061663 | 3300001661 | Forest Soil | MRKFSSLLRSAPSRIGRRIALIVAIAAASLPAAGA* |
| JGI12053J15887_100135353 | 3300001661 | Forest Soil | MRQVTLLLRSVPSRIGRRLALIVAIAAASLPSAGV* |
| JGI12053J15887_100908212 | 3300001661 | Forest Soil | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAAGA* |
| JGI12053J15887_102118552 | 3300001661 | Forest Soil | MRKFSSLLRSAPSRIGRRIALIVAIAAVSLPAAGA* |
| JGI12627J18819_100509613 | 3300001867 | Forest Soil | MQRMRKLLGSAPSRIGRRLALIAAMAAAGLRDAGA* |
| JGI24770J26754_100453763 | 3300002184 | Freshwater And Sediment | MQQIRSLLRGAPSRIGRRLSQIVAIAAASLPTAGA* |
| JGIcombinedJ26739_1000414153 | 3300002245 | Forest Soil | MRQVNSFLRSASSRIGRRFAEIVAIAAASLPAVGA* |
| JGIcombinedJ26739_1005777601 | 3300002245 | Forest Soil | MAHLNALLRSARSRIGNRLAQIVAIAAASLPAAGLDNA |
| C688J35102_1202330971 | 3300002568 | Soil | MEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA* |
| C688J35102_1208633642 | 3300002568 | Soil | MEDKEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPVAGA* |
| JGI25406J46586_101917342 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSEIVAIAAASLPSAGA* |
| JGI25153J46596_100216573 | 3300003215 | Arabidopsis Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSEIVAIAAASLPLAGA* |
| JGI25404J52841_100425852 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0063455_1012411781 | 3300004153 | Soil | VEAEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0063455_1014846222 | 3300004153 | Soil | MEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0062595_1025143061 | 3300004479 | Soil | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0062594_1008098152 | 3300005093 | Soil | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA* |
| Ga0062594_1012937872 | 3300005093 | Soil | MEDEEMRQVHSLLRGASSRIGRRIAQIVAIAAASLPAAGA* |
| Ga0066683_100520053 | 3300005172 | Soil | MEDEKMRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0066683_109159142 | 3300005172 | Soil | GPMEDEEMQQVRSFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0069003_100767382 | 3300005208 | Natural And Restored Wetlands | MEDREMQQIRSLLRSAPSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0070676_103226302 | 3300005328 | Miscanthus Rhizosphere | PCPPAHMEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070670_1004758472 | 3300005331 | Switchgrass Rhizosphere | MEDEAMQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0068869_1002556912 | 3300005334 | Miscanthus Rhizosphere | MEDEEMRQVRSFLRSAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0068869_1020859392 | 3300005334 | Miscanthus Rhizosphere | MVRAVSAGAMEDEMRQVRTFLRGAPSRIGRRLAQIVAIAAASLPA |
| Ga0068868_1009581493 | 3300005338 | Miscanthus Rhizosphere | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070661_1009223772 | 3300005344 | Corn Rhizosphere | MEDEEMRQVRSLLSSTSSRIARRFAQIVAIAAASLPVAGA* |
| Ga0070671_1015927931 | 3300005355 | Switchgrass Rhizosphere | RPCPPAHMEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070667_1008912452 | 3300005367 | Switchgrass Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070714_1003032071 | 3300005435 | Agricultural Soil | AEGICEMRQLRSLLRTTPSRVRRRLAEIVAIAAASLPAAGV* |
| Ga0070694_1017124921 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSLIVAIAAASLPSAGA* |
| Ga0070663_1000491885 | 3300005455 | Corn Rhizosphere | PCPPAHMEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0070663_1011170241 | 3300005455 | Corn Rhizosphere | VRKTIFPERPCPPAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0070678_1011069362 | 3300005456 | Miscanthus Rhizosphere | MEDKEMRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA* |
| Ga0070678_1016485442 | 3300005456 | Miscanthus Rhizosphere | PCPPAHREDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0077121_102185152 | 3300005511 | Arabidopsis Rhizosphere | MEDKEMRQVRSLLSSASSRIVRRFAQIVAIAAASLPAVGA* |
| Ga0077121_102957541 | 3300005511 | Arabidopsis Rhizosphere | MQQVRSLLRGASSRIGRRLSQIVAIAAASLPEAGA* |
| Ga0077120_10260431 | 3300005513 | Arabidopsis Rhizosphere | MRQVQSLLRNAPARIGRRIAQIVAIAAASLPQAGA* |
| Ga0070741_1000120964 | 3300005529 | Surface Soil | MARLNSILRSTRSRIGQRLSEIVAIAAASLPAAGV* |
| Ga0070734_103854931 | 3300005533 | Surface Soil | MARLNALLQSTRSRIGQRLSQIVAIAAASLPAAGA* |
| Ga0070730_101618402 | 3300005537 | Surface Soil | MRQLSSMLRSARSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0068853_1022550731 | 3300005539 | Corn Rhizosphere | PCPPAHMEDEEMRQVRSLLSSTSSRIARRFAQIVAIAAASLPVAGA* |
| Ga0070733_1000035539 | 3300005541 | Surface Soil | MRQLNALLRSTRSGIGRRLAEIVAIAAASLPAVGA* |
| Ga0070672_1003656492 | 3300005543 | Miscanthus Rhizosphere | MRQLSSLLRAAPSRIGRRFKLIVAIAAASLPSAGA* |
| Ga0070672_1011077692 | 3300005543 | Miscanthus Rhizosphere | MRQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070686_1002015671 | 3300005544 | Switchgrass Rhizosphere | PCPPAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0070665_1003573803 | 3300005548 | Switchgrass Rhizosphere | MRQVGIFLRKAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070665_1009843732 | 3300005548 | Switchgrass Rhizosphere | MRQVRSLLSSTSSRIARRFAQIVAIAAASLPVAGA* |
| Ga0070665_1010384562 | 3300005548 | Switchgrass Rhizosphere | MEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0070665_1010836411 | 3300005548 | Switchgrass Rhizosphere | MRQVQSYLRAAPARIGRRIAQIVAIAAASLPQAGA* |
| Ga0070665_1019393802 | 3300005548 | Switchgrass Rhizosphere | MEDKKMRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA* |
| Ga0066701_102471852 | 3300005552 | Soil | MRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0066707_105300871 | 3300005556 | Soil | MRQVRSLLRGASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0066707_105809192 | 3300005556 | Soil | MRKVGSLLRAAPSRIGRRLAQIVAIAAASLPHAGA* |
| Ga0066704_102020763 | 3300005557 | Soil | IYHMRQVGSLLRSAPSRIRRRLALIVAIAAASLPSAGA* |
| Ga0066704_102899572 | 3300005557 | Soil | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0066670_100293003 | 3300005560 | Soil | MRRINLLLRTTRSRIGRRLAEMVAIAAASLPAAGA* |
| Ga0068855_1001070031 | 3300005563 | Corn Rhizosphere | MKQIRSFLRGAPSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0068855_1004799341 | 3300005563 | Corn Rhizosphere | DMRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAAGV* |
| Ga0070664_1017357551 | 3300005564 | Corn Rhizosphere | MRQDRSLLRGASSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0066703_104291032 | 3300005568 | Soil | MRQVRLLLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0066694_100721542 | 3300005574 | Soil | MRALGSLLYVAPSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0068857_1000625572 | 3300005577 | Corn Rhizosphere | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAAGV* |
| Ga0066691_105689971 | 3300005586 | Soil | LCDMRKFSSLLRSAPSRIGRRMALIVAIAAASLPAAGA* |
| Ga0066706_115152603 | 3300005598 | Soil | MRQINSLLRTTPSRIGRRLAEIVAIAAASLPAVGA* |
| Ga0070762_100122443 | 3300005602 | Soil | MKVMARLNALLRSTQSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0070762_104057192 | 3300005602 | Soil | MRRLGSFLGFAPSRIKRRLALIVAIAAASLPAAGA* |
| Ga0070762_106408142 | 3300005602 | Soil | GIRGMRQVASLLRLAPSRIGRRLALIVAIAAASLPAAGA* |
| Ga0070763_109728812 | 3300005610 | Soil | MQQLSSLLRSIRSRIGGSLSLIVAIAAASLPAAGA* |
| Ga0068859_1004138681 | 3300005617 | Switchgrass Rhizosphere | MRPLRSVFHAAKSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0068859_1013565062 | 3300005617 | Switchgrass Rhizosphere | MRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0073904_101707052 | 3300005660 | Activated Sludge | MRQLRSLLRAAPSRIGRRLKLIVAIAAASLPSAGA* |
| Ga0070764_110282422 | 3300005712 | Soil | MARLNALLLVTRSRIEHRFSQIVAIAAASLPVAGA* |
| Ga0068866_103983992 | 3300005718 | Miscanthus Rhizosphere | MQQVRSLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0068851_102102762 | 3300005834 | Corn Rhizosphere | MQQVRKLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0068870_111723702 | 3300005840 | Miscanthus Rhizosphere | MEDEEMQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0068863_1001771003 | 3300005841 | Switchgrass Rhizosphere | MRQVQSLLRTTRLRIGRRLALIVAIAAASLPQAGA* |
| Ga0068858_1001247054 | 3300005842 | Switchgrass Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASL |
| Ga0068858_1001271123 | 3300005842 | Switchgrass Rhizosphere | EDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0068858_1011758201 | 3300005842 | Switchgrass Rhizosphere | CPPAHMEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0068862_1022667582 | 3300005844 | Switchgrass Rhizosphere | EDEEMRQVRSLLSSTSSRIARRFAQIVAIAAASLPVAGA* |
| Ga0070766_103267432 | 3300005921 | Soil | MARLNALLRSTQSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0081455_104946732 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MEDEEMRQVRSLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0081540_100125214 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MRQVRTFLRNAPSRIGRRFAQIVAIAAASLPAAGA* |
| Ga0081540_10214944 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAQVRSLLRNAPSRIGRRFAQIVAIAAASLPAAGA* |
| Ga0081539_104534252 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MEDGEMRQVRSLLSSASSRIGRRLSEIVAIAAASLPSAGA* |
| Ga0066789_100957522 | 3300005994 | Soil | MRQVGSLLRSVPSRIGRRLALIVAIAAESLPSAGA* |
| Ga0066789_102391111 | 3300005994 | Soil | MRQVQSLLRTTRARIGRKLALIVAIAAASLPQAGA* |
| Ga0070717_100063236 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHLNSLLRSRRSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0070717_117701502 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLRSLLRSAPSRIGRRFAQIVAIAAASLPDAGA* |
| Ga0066651_107506982 | 3300006031 | Soil | MEDEEMRLVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075365_100587424 | 3300006038 | Populus Endosphere | MRQVRSWLSSTSSRIARRFAQIVAIAAASLPVAGA |
| Ga0075365_103407291 | 3300006038 | Populus Endosphere | PPAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0075365_109660761 | 3300006038 | Populus Endosphere | DEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075365_110539881 | 3300006038 | Populus Endosphere | LPPAHMEDEEMRQVRSLLSSASSRIGRRLSEIVAIAAASLPSAGA* |
| Ga0075368_101905771 | 3300006042 | Populus Endosphere | MRQVQNFLRSAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075368_103229531 | 3300006042 | Populus Endosphere | CPPAHMEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075363_1002566862 | 3300006048 | Populus Endosphere | MEDEEMRQVRSLLSSTSSRIGHRLSQIVAIAAASLPSVGA* |
| Ga0075028_1005774802 | 3300006050 | Watersheds | MRQVASLLRAAPSRIGRCLAQIVAIAAASLPAAGA* |
| Ga0075364_110218742 | 3300006051 | Populus Endosphere | MRQVRSLLSSASSRIGRRLSEIVAIAAASLPSAGA* |
| Ga0097691_10150514 | 3300006055 | Arctic Peat Soil | MRQLRSLLQSAPARIGRRFAQIVAIAAASLPAAGA* |
| Ga0075026_1001121131 | 3300006057 | Watersheds | PCPPAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPDAGA* |
| Ga0075026_1005998611 | 3300006057 | Watersheds | MRQFSSLLRSTRSRIGRRLAEIVAIAAASLPAVGA* |
| Ga0075026_1006304761 | 3300006057 | Watersheds | QQLRSLLRTAPSRVRRRIAEIVAIAAASLPAAGV* |
| Ga0075017_1001480992 | 3300006059 | Watersheds | MRQFRSLLRSTRSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0075017_1005019642 | 3300006059 | Watersheds | MQQLRSLLRTAPSRVRRRIAEIVAIAAASLPAAGV* |
| Ga0075019_100216143 | 3300006086 | Watersheds | MDMRPFHSLLRSTRSRIARRLAEIVAIAAASLPTAGA* |
| Ga0075015_1000113866 | 3300006102 | Watersheds | MIDMRPLHSILRSTRSRIARRLAEIVAIAAASLPTAGA* |
| Ga0075015_1008694931 | 3300006102 | Watersheds | MQQIRSLLRGAPTRIGRRLSQIVAIAAASLPSVGA* |
| Ga0070715_102974842 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQFGLLLRSTRSRIGRRLALIVAIAAASLPAAGA* |
| Ga0075018_101478873 | 3300006172 | Watersheds | MRRINSLLRTAPSLIRRRLAEIVAIAAASLPAAGA* |
| Ga0075014_1005527131 | 3300006174 | Watersheds | MIDMQPLNSLLRSTRSRIGRRLAEIVAIAAASLPAVGA* |
| Ga0075367_103815502 | 3300006178 | Populus Endosphere | MRQVQNFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075367_110166091 | 3300006178 | Populus Endosphere | AHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0075369_103701992 | 3300006186 | Populus Endosphere | MEDVQMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0075366_108985101 | 3300006195 | Populus Endosphere | PCPPAHMEDEEMRQVRSFLRSAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0097621_1015037752 | 3300006237 | Miscanthus Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA* |
| Ga0075448_1000004211 | 3300006352 | Marine | MRGVQSLLRNAPAKIGRRLAQIVAIAAASLPQAGA* |
| Ga0075021_103497182 | 3300006354 | Watersheds | MRQFRSLLRSTRSRIGRRLAEIVAIAAASLPAAGV* |
| Ga0074050_111372171 | 3300006577 | Soil | MRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0074059_116135982 | 3300006578 | Soil | CPPAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0074062_121761762 | 3300006606 | Soil | MAQVRSLLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0066653_105423032 | 3300006791 | Soil | MQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0066659_103084712 | 3300006797 | Soil | MRRINLLLRTTRSRIGRRLAEIVAIAAASLPGAGA* |
| Ga0066660_102366332 | 3300006800 | Soil | MRQVGSLLRNVPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0066797_10916673 | 3300006864 | Soil | GIGDMRQLGLLLRSTRSRIGRRLALIVAIAAASLPAAGA* |
| Ga0068865_1004462282 | 3300006881 | Miscanthus Rhizosphere | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASL |
| Ga0068865_1016819451 | 3300006881 | Miscanthus Rhizosphere | CAPCPPAHMEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0073928_100472154 | 3300006893 | Iron-Sulfur Acid Spring | MRQLRSLLRGTPGRIGRRFAEIVAIAAASLPAAGA* |
| Ga0075424_1006295092 | 3300006904 | Populus Rhizosphere | PAHMEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0099825_10340081 | 3300006941 | Root Nodules | MMRQVQTLLRTAPAKIRRRFAQIVAIAAASLPQAGA* |
| Ga0075524_102899942 | 3300006950 | Arctic Peat Soil | MQQLRSLLRATPSRLRRRIAEIVAIAAASLPAAGA* |
| Ga0079219_101874122 | 3300006954 | Agricultural Soil | CAVFYTARTEGEEMRQVHTLLRGASSRIRRRLAQIVAIAAASLPTAGA* |
| Ga0099795_101839772 | 3300007788 | Vadose Zone Soil | MQQVRSLLRGASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0099795_102165162 | 3300007788 | Vadose Zone Soil | MQQLRSFLRGAPSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0105251_106442652 | 3300009011 | Switchgrass Rhizosphere | RQVRSFLRNAPSRIGRRLAQIVAIAAASLPAVGA* |
| Ga0066710_1046111171 | 3300009012 | Grasslands Soil | MEDQKMRQVRSLLRGAPSRIGRRLAQIVAIAAASLSAAGA |
| Ga0105106_108237422 | 3300009078 | Freshwater Sediment | MRQLGSLLRSAPSRIGRRLKLIVAIAAASLPSAGA* |
| Ga0105245_102598683 | 3300009098 | Miscanthus Rhizosphere | MRQVQTLLRTAPARIGRRIARIVAIAAASLPQAGA* |
| Ga0105245_125825262 | 3300009098 | Miscanthus Rhizosphere | EDEEMRQVRSLLSHASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0075418_101218472 | 3300009100 | Populus Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0105247_109197592 | 3300009101 | Switchgrass Rhizosphere | MRQVQQFLRKAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0115026_119370921 | 3300009111 | Wetland | MRQLGSLLRSAPSRIGHRLKLIVAIAAASLPSVGA* |
| Ga0115923_108792962 | 3300009112 | Swimming Pool Sandfilter Backwash | MEGQPMRQIHPFLRDALSRIGRRLALIVAIAAASLPVAGA* |
| Ga0066709_1036421641 | 3300009137 | Grasslands Soil | MRQVRSLLRGAPSRIGRRLAQIVAIAAASLSAAGA* |
| Ga0099792_104183722 | 3300009143 | Vadose Zone Soil | MQQLRSLLRGAPSRIGRRLSEIVAIAAASLPAAGA* |
| Ga0099792_104412161 | 3300009143 | Vadose Zone Soil | MRKVGSLLRAVPSRIGRRLAAIVAIAAASLADAGA* |
| Ga0075423_112270282 | 3300009162 | Populus Rhizosphere | MRQVHSLLRGASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0105241_114923591 | 3300009174 | Corn Rhizosphere | GADGRCEMQQIRSLLRGAPSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0105242_115141221 | 3300009176 | Miscanthus Rhizosphere | MRQVRSFLRSAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0105248_103381531 | 3300009177 | Switchgrass Rhizosphere | KMQQVRSLLRGAPSRIGRRLAQIVAIAAASLPVAGA* |
| Ga0105237_117668452 | 3300009545 | Corn Rhizosphere | MRQVQTLLRTAPARIGRRIAQIVAIAAASLPQAGA* |
| Ga0116125_10958882 | 3300009628 | Peatland | MQEFTSLLRSARSRIGRRLRLIVAIAAASLPAAGA* |
| Ga0126313_107555952 | 3300009840 | Serpentine Soil | MEDKEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0126315_100295172 | 3300010038 | Serpentine Soil | MEDEEMRQIRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0126382_118196681 | 3300010047 | Tropical Forest Soil | REEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA* |
| Ga0126373_116443321 | 3300010048 | Tropical Forest Soil | AEGLLEMERVRSLLRSTPSRLSRRLAQIVAIAAASLPEAGA* |
| Ga0133944_1000097193 | 3300010052 | Liquid | MRQVQSLLRNAPARIGRRLAQIVAIAAASLPQAGA* |
| Ga0099796_100043141 | 3300010159 | Vadose Zone Soil | SCDMRRIGSLLRAAPSRIGRRLALIVAIAAASLPSAGA* |
| Ga0099796_105623812 | 3300010159 | Vadose Zone Soil | MQEMQQVRSLLRDASSRIGRRLAQIVAIAAASLPVAGA* |
| Ga0126306_112534191 | 3300010166 | Serpentine Soil | MRKVGSLLRAAPSRIGRRIAQFVALAAASLPHAGA* |
| Ga0134065_102270592 | 3300010326 | Grasslands Soil | VEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0126372_132360682 | 3300010360 | Tropical Forest Soil | AMRRINSLLRSTRSRIGKRLSLIVAIAAASLPSAGA* |
| Ga0105239_111070481 | 3300010375 | Corn Rhizosphere | MQQIRSLLRGAPSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0136449_1002070323 | 3300010379 | Peatlands Soil | MRRINSLLRATPSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0136449_1009916632 | 3300010379 | Peatlands Soil | MRQFSSLLRSARSRIGRGLAQFVAIAAASLPVAGV* |
| Ga0134126_104747381 | 3300010396 | Terrestrial Soil | MRPLRSVFHAAKSSIGRRLAEIVAIAAASLPAAGA* |
| Ga0134126_107959702 | 3300010396 | Terrestrial Soil | MQQVAFLLRKAPSRIAHRLSQLIAIAAASLPEVGA* |
| Ga0134124_103879861 | 3300010397 | Terrestrial Soil | DEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA* |
| Ga0134124_113961092 | 3300010397 | Terrestrial Soil | CPPAHMEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0126357_12598592 | 3300010864 | Boreal Forest Soil | MRQLNALLRSAPSRIGRRLALIVAIAAASLPAAGA* |
| Ga0126344_10635472 | 3300010866 | Boreal Forest Soil | MQRLSSLLRATPSRIGRLALIVAIAAASLPAAGA* |
| Ga0126350_103091122 | 3300010880 | Boreal Forest Soil | MRQLSSLLRATRSRIGRRLAQIVAIAAASLAVAGA* |
| Ga0126350_103892772 | 3300010880 | Boreal Forest Soil | MRQLRSLLRSAPSRIGRRFAEIVAIAAASLPAAGA* |
| Ga0105246_109669012 | 3300011119 | Miscanthus Rhizosphere | MQQVRSLLRGAPSRIGRRLAQIVAIAAASLPVAGA* |
| Ga0105246_120232101 | 3300011119 | Miscanthus Rhizosphere | MEDEMRQVGTFLRNAPCRIGRRLAQIVAIAAASLPAAGA* |
| Ga0150983_110800261 | 3300011120 | Forest Soil | GKCEMRQVASLLRKAPARIGRRLAQIVAIAAASLPAAGA* |
| Ga0150983_112720862 | 3300011120 | Forest Soil | GATGKCEMRQVASLLRRAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137392_102332372 | 3300011269 | Vadose Zone Soil | MRRINSLLRAAPARIRRRIAEIVAIAAASLPAAGA* |
| Ga0137463_10267622 | 3300011444 | Soil | MRRIGSLLRAAPSRIGRRLALIVAIAAASLPSAGA* |
| Ga0137389_116432612 | 3300012096 | Vadose Zone Soil | MRQLRSLLRSTPSRIARRLAEIVAIAAASLPTAGA* |
| Ga0137382_103662611 | 3300012200 | Vadose Zone Soil | MRQFGSLLRSTQSRIARRLAEIVAIAAASLPAAGA* |
| Ga0137363_100547182 | 3300012202 | Vadose Zone Soil | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAVGA* |
| Ga0137374_106070341 | 3300012204 | Vadose Zone Soil | MRQVQSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137374_109599891 | 3300012204 | Vadose Zone Soil | EDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137362_111777441 | 3300012205 | Vadose Zone Soil | MARKEFFEMRQLGSMLRSAPARIGRRFAEIVAIAAASLPAAGA* |
| Ga0137377_115764461 | 3300012211 | Vadose Zone Soil | MRRINLLLRTTPSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0137377_116986392 | 3300012211 | Vadose Zone Soil | MAQVRALLRTAPSRIGRRLAQIVAIAAASLPQAGA* |
| Ga0150985_1007658393 | 3300012212 | Avena Fatua Rhizosphere | MRQVQSLLRTARLRIGRKLALIVAIAAASLPQAGA* |
| Ga0150985_1038143322 | 3300012212 | Avena Fatua Rhizosphere | MRQVTSFLRAAPSRIGRRLADIVAIAAASLPAAGA* |
| Ga0150985_1051200382 | 3300012212 | Avena Fatua Rhizosphere | MQQVQSLLRTTRLRIGRKLALIVAIAAASLPQAGA* |
| Ga0137386_102944012 | 3300012351 | Vadose Zone Soil | MQQVRSFLRAAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137369_100746191 | 3300012355 | Vadose Zone Soil | MRQVQSFLRNAPSRIGRRLAQIVDIDAASLPAAGA* |
| Ga0137384_100169652 | 3300012357 | Vadose Zone Soil | MRRINLLLRTTPSRIGRSLAQSVAIAAASLPAAGA* |
| Ga0137385_101433712 | 3300012359 | Vadose Zone Soil | MAQVRALLRTAPSRIGRKLAQIVAIAAASLPAAGA* |
| Ga0137385_108186432 | 3300012359 | Vadose Zone Soil | MAQVRALLRTATSRIGRKLAQIVAIAAASLSAAGA* |
| Ga0137360_108906272 | 3300012361 | Vadose Zone Soil | LVKLVALAHMEDREMRQVRLLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0150984_1013039432 | 3300012469 | Avena Fatua Rhizosphere | VEAEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA* |
| Ga0150984_1048584872 | 3300012469 | Avena Fatua Rhizosphere | MQQVRKLLSGAPARIGRRLAQIIAIAAASLPAAGA* |
| Ga0150984_1154619092 | 3300012469 | Avena Fatua Rhizosphere | MRQLRSLLRAAPGRIGRRLAQIVAIAAASLPSAGA* |
| Ga0150984_1222741531 | 3300012469 | Avena Fatua Rhizosphere | PAHMEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137358_105903251 | 3300012582 | Vadose Zone Soil | MQKVRSLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137397_100769934 | 3300012685 | Vadose Zone Soil | MEDEEMRQVRLLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137397_101730242 | 3300012685 | Vadose Zone Soil | MEDREMRQVRLLLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0157294_101652222 | 3300012892 | Soil | MRQVRSLLSSASARIARRFAQIVAIAAASLPVAGA* |
| Ga0157294_102747962 | 3300012892 | Soil | MQRLNTLLRSAPSRIGRQLKLIVAIAAASLPSAGA* |
| Ga0157284_100292552 | 3300012893 | Soil | MEDKEMRQVRSLLSSASSRIARRFAQIVAIAAASLPVAGA* |
| Ga0157293_102404552 | 3300012898 | Soil | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSVGA* |
| Ga0157308_101612752 | 3300012910 | Soil | MQRLNTLLRSAPSRIGRQFKLIVAIAAASLPSAGA* |
| Ga0137396_103205392 | 3300012918 | Vadose Zone Soil | MRQVTSFLRAAPSRIGRRLVQIVAIAAASLPAAGV* |
| Ga0137413_105645341 | 3300012924 | Vadose Zone Soil | MQQVRSLLRDAPSRIGRRLAKIVAIAAASLPAAGA* |
| Ga0137413_113675602 | 3300012924 | Vadose Zone Soil | MRQLRSLLRAAPSRIGRRLSQIVAIAAASLAAAGV* |
| Ga0137413_115275101 | 3300012924 | Vadose Zone Soil | MEDQQMQQVRSFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137419_101190832 | 3300012925 | Vadose Zone Soil | MRQVGSLLRSAPSRIRRRLALIVAIAAASLPAAGA* |
| Ga0137416_109557941 | 3300012927 | Vadose Zone Soil | CDMRRIGSLLRAAPSRIGRRLALIVAIAAASLPSAGA* |
| Ga0137416_121791612 | 3300012927 | Vadose Zone Soil | MRKFSSLLRSAPSRIGRRMALIVAIAAASLPAAGA* |
| Ga0137404_100220313 | 3300012929 | Vadose Zone Soil | MEDREMRQVRLLLRGAQSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0137404_100252875 | 3300012929 | Vadose Zone Soil | MRYFGSLLRSTRFRIARRLAQIVAIAAASLAAAGA* |
| Ga0137404_100382352 | 3300012929 | Vadose Zone Soil | MQQLRSLLRSAPSRIGRRLSQIVAIAAASLPVAGA* |
| Ga0137407_117761311 | 3300012930 | Vadose Zone Soil | MLQFGSLLRSTRSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0153915_107369002 | 3300012931 | Freshwater Wetlands | MRQLRSLLRAAPSRIGRRIAEIVAIAAASLPAAGA* |
| Ga0153915_118744721 | 3300012931 | Freshwater Wetlands | MRQLRSLLRTTPSRIGRRIAQIVAIAAAILPDAGA* |
| Ga0162653_1000696461 | 3300012937 | Soil | MEDEEMRQVRSLLSTASSRIGRRLSLIVAIAAASLPSAGA* |
| Ga0137410_101154752 | 3300012944 | Vadose Zone Soil | MRQLNRLLRSAPSRIGRRLALIVAIAAASLPSAGV* |
| Ga0137410_106793852 | 3300012944 | Vadose Zone Soil | MQQVRSLLRGASSRIGRRVAQIVAIAAASLPVAGA* |
| Ga0164300_101063923 | 3300012951 | Soil | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLSSAGA* |
| Ga0164299_112365142 | 3300012958 | Soil | MEDEEMRQVHSLLRGASSRIGRRLDQIVAIAAASLPAAGA* |
| Ga0126369_106221512 | 3300012971 | Tropical Forest Soil | MFDMRHFNSLLRSTGWRIGRRLAEIVAIAAASLPAAGA* |
| Ga0168316_1013148 | 3300012981 | Weathered Mine Tailings | MRQVRSLLRGASIRFGRRLSQIVAIAAASLPQAGA* |
| Ga0164308_106907831 | 3300012985 | Soil | ADGRCEMQQVRSLRRGAPSRIGRRLAQIVAIAAGSLPAAGA* |
| Ga0164304_105530961 | 3300012986 | Soil | MRQLGSLLRSAPSRIGRRFAQIVAIAAASLPSAGA* |
| Ga0164307_113854682 | 3300012987 | Soil | MEDKEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0164306_120021141 | 3300012988 | Soil | RGINDMRQLRSLLRSAPSRIGRRFAQIVAIAAASLPDAGA* |
| Ga0157369_102876072 | 3300013105 | Corn Rhizosphere | MQQVAVLFRQARSRFGHRLAQLIAIAAASLPEVGA* |
| Ga0157378_123889252 | 3300013297 | Miscanthus Rhizosphere | RWKIEMRQVQTFLRNAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0163162_125682762 | 3300013306 | Switchgrass Rhizosphere | VVPAQMEDEEMRQVHSLLRGASSRIGRRIAQIVAIAAASLPAAGA* |
| Ga0120158_105114261 | 3300013772 | Permafrost | MQQLNSLLRSAPSRVGRRLALIFAIAAASLPAAGA* |
| Ga0181528_100517202 | 3300014167 | Bog | MRQLRSLLRAAPSRIGRRLAEIVAIAAASLPAAGA* |
| Ga0181528_105580992 | 3300014167 | Bog | MRQLRSLLRAAPSRVRRRLAEIVAIAAASLPAAGA* |
| Ga0181531_101142431 | 3300014169 | Bog | MQQFTSLLRSARSRIGRRLSLIVAIAAATLPAAGA* |
| Ga0075323_10139152 | 3300014301 | Natural And Restored Wetlands | MQQVRSFLRGAPSRIGRRLAQLVAIAAASLPEAGA* |
| Ga0157380_100226092 | 3300014326 | Switchgrass Rhizosphere | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGT* |
| Ga0157380_102409673 | 3300014326 | Switchgrass Rhizosphere | MEDLQMRQVQTMLRGASSRIGRRLAQIVAIAAASLPAAGS* |
| Ga0182010_100678983 | 3300014490 | Fen | MRKLGSLLRATPSRIGRRIAQIVAIAAASLPAAGA* |
| Ga0182013_102249322 | 3300014492 | Bog | MRQLRSLLRAAPSRIGRRLAKIVAIAAASLPAAGA* |
| Ga0182013_103216321 | 3300014492 | Bog | MRRLGSLLSSAPSRIRRRVALIVAIAAASLPAAGA* |
| Ga0182015_106628342 | 3300014495 | Palsa | MQQLTSLLRSARSRIGRRLSLIVAIAAASLPAAGA* |
| Ga0182024_106473593 | 3300014501 | Permafrost | MKKVNSLLRSAPSRIGRRFAEIVAIAAASLPAAGA* |
| Ga0182024_118469641 | 3300014501 | Permafrost | GNATMRQLGSLLRSAPSRVRRRLAEIVAIAAASLPAAGA* |
| Ga0181525_102145171 | 3300014654 | Bog | AHLNSLLRSVRSRMSRRFAQIVAIAAASLPAAGV* |
| Ga0181525_103838961 | 3300014654 | Bog | VGVLGIRAMRQVASLLRSVPSRIGRRLALIAAIAAVSLPAAGA* |
| Ga0181525_104182952 | 3300014654 | Bog | MQQFTSLLRSARSRIGRRLSLIVAIAAASLPAAGA* |
| Ga0181522_110525141 | 3300014657 | Bog | QGNATMRQLRSLLRSAPSRIGRRFVQIVAIAAASLPAAGA* |
| Ga0157377_100416121 | 3300014745 | Miscanthus Rhizosphere | IFPVRPCPPAHMEDEEMRQVRSLLSSASSRVGRRLSQIVAIAAASLPSAGA* |
| Ga0157376_122842581 | 3300014969 | Miscanthus Rhizosphere | MARLNALLLSTRSRIGRRLSQIVAIAAASLPAVGA* |
| Ga0137414_11980202 | 3300015051 | Vadose Zone Soil | MEDQEMQQVRSFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0173483_106511491 | 3300015077 | Soil | MEDLQMRQVQTMLRGASSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0173483_108604512 | 3300015077 | Soil | EMRQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0167643_10006374 | 3300015089 | Glacier Forefield Soil | MRRLTLLLRATPSRIGRRLALIVAIAAASLPAAGA* |
| Ga0173480_101429752 | 3300015200 | Soil | MRQVRSFLRNAPSRIGRRLAQIVAIAAASLPSAGA* |
| Ga0173480_107238062 | 3300015200 | Soil | MRQVRSLLSSASARIARRFAQIVAIAAASLPAVGA* |
| Ga0173480_108370672 | 3300015200 | Soil | MRQLNTLLRSAPSRIRRRLALIVAIAAASLPSAGA* |
| Ga0173480_110559842 | 3300015200 | Soil | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPDAGA* |
| Ga0167644_10002952 | 3300015206 | Glacier Forefield Soil | MRQLRSLLRSAPARIGRRFAEIVAIAAASLPAAGA* |
| Ga0167644_10874001 | 3300015206 | Glacier Forefield Soil | MRQLRSLLRFAPARIGRRFAEIVAISAASLPAAGA* |
| Ga0167644_10922452 | 3300015206 | Glacier Forefield Soil | MRQLRSLLRSAPARVRRRLAEIVAIAAASLPAAGA* |
| Ga0137409_109384083 | 3300015245 | Vadose Zone Soil | ITEDNEMAQVRALLRTAPSRIGRKLAQIVAIAAASLPAAGA* |
| Ga0137403_104338622 | 3300015264 | Vadose Zone Soil | MEDEEMQQVRTFLRAAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0132258_137040552 | 3300015371 | Arabidopsis Rhizosphere | MRQVQSLLRNAPAKIGRRLAQIVAIAAASLPQAGA* |
| Ga0132255_1060255381 | 3300015374 | Arabidopsis Rhizosphere | MENEMRQVQNFLRKAPSRIGRRLAQIVAIAAASLPAAGA* |
| Ga0182036_100196451 | 3300016270 | Soil | MRRLNSLLRSTRWRIGRRLAEIVAIAAASLPAAGV |
| Ga0163161_114446902 | 3300017792 | Switchgrass Rhizosphere | MRQVASLLRKAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0163161_114627701 | 3300017792 | Switchgrass Rhizosphere | EMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA |
| Ga0187847_100866402 | 3300017948 | Peatland | MQEFTSLLRSARSRIGRRLRLIVAIAAASLPAAGA |
| Ga0190266_109901282 | 3300017965 | Soil | MEDKEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0184604_101288501 | 3300018000 | Groundwater Sediment | MRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0184605_101716411 | 3300018027 | Groundwater Sediment | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0184605_105187221 | 3300018027 | Groundwater Sediment | MRRIGSLLRAAPSRIGRRLALIVAIAAASLPSAGA |
| Ga0184608_101402132 | 3300018028 | Groundwater Sediment | MEDEEMRQVHSLLSTASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0187887_101358112 | 3300018043 | Peatland | MRQLRSLLRSAPSRIGRRFVQIVAIAAASLPAAGA |
| Ga0184621_102032412 | 3300018054 | Groundwater Sediment | MRQVRSFLRNAPSRIGRRLAQIVAIAAASLPVAGA |
| Ga0184616_103312702 | 3300018055 | Groundwater Sediment | MRQLRSLLRSAPSRIGRRFKLIVAIAAASLPSAGA |
| Ga0187773_100073222 | 3300018064 | Tropical Peatland | MRPLKSLLRAARSRIGRRLAGIVAIAAASLPAAGA |
| Ga0184625_104849712 | 3300018081 | Groundwater Sediment | MEDEEMRQVRLLLSSASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0194136_10007395 | 3300018412 | Watersheds | MRGVQSLLRNAPAKIGRRLAQIVAIAAASLPQAGA |
| Ga0190272_103002491 | 3300018429 | Soil | MRQVQTLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0190272_108050722 | 3300018429 | Soil | MEDQEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0190272_129347522 | 3300018429 | Soil | GDMRQVNSFLRSASSRIGRRLKLIVAIAAASLPSAGA |
| Ga0066655_103204452 | 3300018431 | Grasslands Soil | MRRINLLLRTTRSRIGRRLAEMVAIAAASLPAAGA |
| Ga0066655_108784031 | 3300018431 | Grasslands Soil | MEDEKMRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA |
| Ga0190275_129812963 | 3300018432 | Soil | GEMRQLGSMLRAAPSRIGRRLKLIVAIAAASLASAGA |
| Ga0190268_106079512 | 3300018466 | Soil | MEDDEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0190268_120681451 | 3300018466 | Soil | MRKVGSLLRAAPSRIGRRIAQFVALAAASLPHAGA |
| Ga0066662_102209732 | 3300018468 | Grasslands Soil | MPRINLLLRTTRSRIGRRLAEIVAIAAASLPAAGA |
| Ga0066662_107678702 | 3300018468 | Grasslands Soil | MQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0066662_110859422 | 3300018468 | Grasslands Soil | MRASFALLSSARTRIGRRLAEIVAIAAASLPSVGA |
| Ga0066662_125603292 | 3300018468 | Grasslands Soil | MRQVQSLLRTTRRRIGRKLALIVAIAAASLPQAGA |
| Ga0190270_106711891 | 3300018469 | Soil | MQRLNTLLRSAPSRIGRQLKLIVAIAAASLPSAGA |
| Ga0190274_120740552 | 3300018476 | Soil | MEDKEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0190274_130561322 | 3300018476 | Soil | APCPPAHREDEEMRQVRSLLSSASSRIARRFAQIVAIAAASLPVAGA |
| Ga0190271_113069913 | 3300018481 | Soil | EGTGEMRQVNSFLRSASSRIGRRLKLIVAIAAASLPSAGA |
| Ga0066669_104542212 | 3300018482 | Grasslands Soil | MRQVRSLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0066669_112745311 | 3300018482 | Grasslands Soil | MEDEEMQQVRSFLRAAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0190273_100353984 | 3300018920 | Soil | MEDKEMRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA |
| Ga0190264_110413572 | 3300019377 | Soil | MEDEMRQVGTFLCNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0137408_11790683 | 3300019789 | Vadose Zone Soil | MRYFGSLLRSTRFRIARRLAQIVAIAAASLAAAGA |
| Ga0193725_100098110 | 3300019883 | Soil | MRRIGSLLRAAPSRIGRRLALIVAIAAASLPAAGA |
| Ga0193729_11578722 | 3300019887 | Soil | EMRQVGSLLRSAPSRIRRRLALIVAIAAASLPAAGA |
| Ga0193729_11895503 | 3300019887 | Soil | MAQVRALLRTAPSRIGRKLAQIVAIAAASLPQAGA |
| Ga0193743_10384493 | 3300019889 | Soil | MRQVRTFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0193717_10124572 | 3300020060 | Soil | MQQLSSLLRSTRSRIGRRLSLIVAIAAASLPGAGV |
| Ga0179592_100071397 | 3300020199 | Vadose Zone Soil | MRQFGSLLRSTQSRIARRLAEIVAIAAASLPAAGA |
| Ga0210407_100483724 | 3300020579 | Soil | MKVMARLNALLRSTQSRIGRRLAEIVAIAAASLPAAGA |
| Ga0210407_101226861 | 3300020579 | Soil | MRDFGSLLRSTRSRIARRLAQIVAIAAASLPAAGA |
| Ga0210407_101596013 | 3300020579 | Soil | MRRINSLLRSTRARIGKRLSLIVAIAAASLPDAGA |
| Ga0210395_105306922 | 3300020582 | Soil | MINMRQLNALLRTTRSHVGRRLAQIVAIAAASLPAVGA |
| Ga0210401_100062695 | 3300020583 | Soil | MRRFNSLLRSVRSRIGRRLAQIVAIAAESLPAAGA |
| Ga0210401_100968854 | 3300020583 | Soil | MQQLSSLLRSTRSRIGRRLSLIVAIAAASLPAAGA |
| Ga0210382_104643451 | 3300021080 | Groundwater Sediment | APNGRCQMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0210380_100161583 | 3300021082 | Groundwater Sediment | MEDEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0210380_103009432 | 3300021082 | Groundwater Sediment | MQRFNTLLRSAPSRIGRQLKLIVAIAAASLPSAGA |
| Ga0210404_100032607 | 3300021088 | Soil | MRRLRSLLRSTFSRIGRRLALIVAIAATSLPAAGA |
| Ga0210404_100260014 | 3300021088 | Soil | MRQLGSLLRSTSSRIGRRLALIVAIAAASLPAVGA |
| Ga0210406_101009182 | 3300021168 | Soil | MRQLRALLGKTPSRLRRRIAEFVAIAAASLPAAGA |
| Ga0210406_104377782 | 3300021168 | Soil | MTDMRSIHALLRSTRSRIGRRLAEIVAIAAASLPAVGA |
| Ga0210400_102011243 | 3300021170 | Soil | MQRLSSLLRATPSRIGRRLALIVAIAAASLPAAGA |
| Ga0210400_111033082 | 3300021170 | Soil | MRKVTSLLRAAPSRIGRRLALIVAIAAASLPAAGA |
| Ga0210400_111276472 | 3300021170 | Soil | MRKVTSVLRSAPSRVGRRLALIVAIAAASLPVAGA |
| Ga0210408_100007173 | 3300021178 | Soil | MRRINSLLRTAPSLIRRRLAQIVAIAAASLPAAGA |
| Ga0210396_100046655 | 3300021180 | Soil | MQQLSSLLRSIRSRIGGSLSLIVAIAAASLPAAGA |
| Ga0210396_104340102 | 3300021180 | Soil | MRQLSSLLRATRSRIGRRLAQVVAIAAASLTVAGA |
| Ga0193719_101454423 | 3300021344 | Soil | CDMRRIGSLLRAAPSRIGRRLALIVAIAAASLPSAGA |
| Ga0213872_103319711 | 3300021361 | Rhizosphere | MRSLSSLLRSAPSRLRRRLILIAEIAAASLPAAGA |
| Ga0193699_100694372 | 3300021363 | Soil | MRRIGSLLRAVPSRIGRRLALIVAIAAASLPSAGA |
| Ga0193699_101742612 | 3300021363 | Soil | MRHVTSLLRSAPSRIGRRLALIVAIAAASLPSAGV |
| Ga0210385_111174391 | 3300021402 | Soil | MMDMRSIHALLRSTRSRIGRRLAEIVAIAAASLPAVGA |
| Ga0210389_100180246 | 3300021404 | Soil | MRQLRSLLRSAPSRIGRRFAEIVAIAAASLPAAGA |
| Ga0210389_105318772 | 3300021404 | Soil | MQRLSSLLRATPSRIGRCLALIVAIAVASLPAAGA |
| Ga0210389_105703532 | 3300021404 | Soil | MRQLRSLLRSAPSRVRRRFAEIVAIAAASLPAAGA |
| Ga0210387_106017902 | 3300021405 | Soil | MQRMRKLLGSAPSRIGRRLALIAAMAAAGLRDAGA |
| Ga0210386_103784541 | 3300021406 | Soil | MRQLSSLLRSTRSRIGRRLAQIVAIAAASLAVAGA |
| Ga0193709_10105972 | 3300021411 | Soil | MRQLRSLLRAAPSRIGRRLSQIVAIAAASLAAAGV |
| Ga0210384_100532011 | 3300021432 | Soil | MRRIHSLLRATPSRIRHRLAEIVAIAAASLPAVGA |
| Ga0210384_107599222 | 3300021432 | Soil | MRKLGSLLRATPSRLRRRLAQIVAIAAASLPAAGA |
| Ga0210391_101521952 | 3300021433 | Soil | MRRLGSFLGFAPSRIKRRLALIVAIAAASLPAAGA |
| Ga0210398_100154597 | 3300021477 | Soil | MINMRQLNALLRTTGSHVGRRLAQIVAIAAASLPAVGA |
| Ga0210402_103534401 | 3300021478 | Soil | IFRGAPGLSPAREENEMAQVRALLRTAPSRIGRKLAQIVAIAAASLPAAGA |
| Ga0210410_102744212 | 3300021479 | Soil | MRRLGSLLRETPSRLRRRLAQIVAIAAASLPAAGA |
| Ga0210410_115980932 | 3300021479 | Soil | AREEICVMRQFGSLLRSAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0210409_100548275 | 3300021559 | Soil | SRMRRINSLLRSTRARIGKRLSLIVAIAAASLPDAGA |
| Ga0213852_14484702 | 3300021858 | Watersheds | MRRINSLLRATPSRIGRRLAEIVAIAAASLPAAGA |
| Ga0213851_13927892 | 3300021860 | Watersheds | MQQLRSLLRTAPSRVRRRIAEIVAIAAASLPAAGV |
| Ga0213853_100352501 | 3300021861 | Watersheds | MRKLRSLLRATPSRIGRRIAEIVAIAAASLPAAGA |
| Ga0193742_10165561 | 3300021976 | Soil | MRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0242648_10138613 | 3300022506 | Soil | SGRQEFSDMRRFNSLLRSVRSRIGRRLAQIVAIAAESLPAAGA |
| Ga0242648_10612801 | 3300022506 | Soil | SCAMRQLGSVLRSTSSRIGRRLALIVAIAAASLPAAGA |
| Ga0222729_10499402 | 3300022507 | Soil | EMRQVASLLRRAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0242655_101379651 | 3300022532 | Soil | QKENEMRQVTSLLRAAPARIGRRLAQIVAIAAASLPAAGA |
| Ga0242662_102249441 | 3300022533 | Soil | GKCEMRQVASLLRKAPARIGRRLAQIVAIAAASLPAAGA |
| Ga0242662_102352981 | 3300022533 | Soil | LPGLSEENEMAQVRALLRSAPSRIGRKLAQIVAIAAASLPAAGA |
| Ga0242662_102704211 | 3300022533 | Soil | LSPAREENEMAQVRALLRTAPSRIGRKLAQIVAIAAASLPAAGA |
| Ga0212123_108462831 | 3300022557 | Iron-Sulfur Acid Spring | MRQLRSLLRGTPGRIGRRFAEIVAIAAASLPAAGA |
| Ga0212090_100183107 | 3300022561 | Glacier Valley | MAQLNAMLRAAPSRIGRRLKLIVAIAAASLPSAGA |
| Ga0242666_11461781 | 3300022721 | Soil | AEGTRDMRQLTLLLRSTRSRIGRRLAQIVDIAAASLPTAGA |
| Ga0242654_102901822 | 3300022726 | Soil | GKCEMRQVTSFLRAAPSRIGRRLAEIVAIAAASLPAAGA |
| Ga0222622_101004343 | 3300022756 | Groundwater Sediment | MENEEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0222622_102191931 | 3300022756 | Groundwater Sediment | MEDEEMRQVRSLLSSASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0222622_102574982 | 3300022756 | Groundwater Sediment | MRQLSSLLRAAPSRIGRRFKLIVAIAAASLPSAGA |
| Ga0222622_110979352 | 3300022756 | Groundwater Sediment | PCAPLPPAHMEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0222622_112150752 | 3300022756 | Groundwater Sediment | MEDEEMQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0247778_10343621 | 3300022894 | Plant Litter | DKEMRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA |
| Ga0247778_11630132 | 3300022894 | Plant Litter | QRRRNGDMQRLNTLLRSAPSRIGRQLKLIVAIAAASLPSAGA |
| Ga0179591_10369124 | 3300024347 | Vadose Zone Soil | MQQLRSLLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0209233_10227442 | 3300025261 | Arabidopsis Rhizosphere | MRQVQSLLRNAPARIGRRIAQIVAIAAASLPQAGA |
| Ga0209758_10043512 | 3300025297 | Arabidopsis Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSEIVAIAAASLPLAGA |
| Ga0209758_10450852 | 3300025297 | Arabidopsis Rhizosphere | MQQVRSLLRGASSRIGRRLSQIVAIAAASLPEAGA |
| Ga0207656_103317472 | 3300025321 | Corn Rhizosphere | MQQVRKLLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0208079_10454162 | 3300025481 | Arctic Peat Soil | MQQLRSLLRATPSRLRRRIAEIVAIAAASLPAAGA |
| Ga0208848_11054122 | 3300025509 | Arctic Peat Soil | MRQLRKLLRAAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0208714_10064762 | 3300025527 | Arctic Peat Soil | MRKLGSLLRETPSRLRRRLAQIVAIAAASLPAAGA |
| Ga0208080_10609172 | 3300025553 | Arctic Peat Soil | MRQLRSLLRSAPARIGRRFAQIVAIAAASLPAAGA |
| Ga0207926_10155643 | 3300025619 | Arctic Peat Soil | MRQLRSLLQSAPARIGRRFAQIVAIAAASLPAAGA |
| Ga0207642_101414363 | 3300025899 | Miscanthus Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA |
| Ga0207710_103291101 | 3300025900 | Switchgrass Rhizosphere | PCPPAHMEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPAVGA |
| Ga0207688_100573172 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA |
| Ga0207680_111061301 | 3300025903 | Switchgrass Rhizosphere | MENEMRQVQNFLRTAPSRIGRRLAQIVAIAAASLPSAGA |
| Ga0207647_100969983 | 3300025904 | Corn Rhizosphere | MRQVQSLLRNAPAKIGRRLAQIVAIAAASLPQAGA |
| Ga0207685_107074061 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQFGLLLRSTRSRIGRRLALIVAIAAASLPAAGA |
| Ga0207645_101156484 | 3300025907 | Miscanthus Rhizosphere | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA |
| Ga0207705_111938181 | 3300025909 | Corn Rhizosphere | MKQIRSFLRGAPSRIGRRLSQIVAIAAASLPAAGA |
| Ga0207671_107913202 | 3300025914 | Corn Rhizosphere | MRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0207671_112690062 | 3300025914 | Corn Rhizosphere | MEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPSVGA |
| Ga0207693_102379592 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RAEGICDMQQLSSLLRSTRSRIGRRLSLIVAIAAASLPAAGA |
| Ga0207662_102005132 | 3300025918 | Switchgrass Rhizosphere | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207657_102216572 | 3300025919 | Corn Rhizosphere | MEDEEMRQVRSLLSSTSSRIARRFAQIVAIAAASLPAVGA |
| Ga0207649_107938951 | 3300025920 | Corn Rhizosphere | MEDEEMRQVRSLLSSTSSRIARRFAQIVAIAAASLPVAGA |
| Ga0207650_112948421 | 3300025925 | Switchgrass Rhizosphere | MEDEAMQQVRTFLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207687_100516664 | 3300025927 | Miscanthus Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207644_107279663 | 3300025931 | Switchgrass Rhizosphere | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPSVGA |
| Ga0207644_110198602 | 3300025931 | Switchgrass Rhizosphere | MEDEEMRQVHSLLSSASSRIGRRLSQIVAIAAASLPSAGA |
| Ga0207690_105027782 | 3300025932 | Corn Rhizosphere | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAMNEPVAGA |
| Ga0207690_113580841 | 3300025932 | Corn Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPA |
| Ga0207706_101291801 | 3300025933 | Corn Rhizosphere | DEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207709_100829442 | 3300025935 | Miscanthus Rhizosphere | MEDEEMRQVHSLLRGASSRIGRRIAQIVAIAAASLPAAGA |
| Ga0207665_105680612 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDEEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPAAGA |
| Ga0207691_104019512 | 3300025940 | Miscanthus Rhizosphere | MGDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA |
| Ga0207711_105110192 | 3300025941 | Switchgrass Rhizosphere | MRQVQQFLRKAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207679_104402501 | 3300025945 | Corn Rhizosphere | VFYTARTKGEEMRQVHTLLRGASSRIRRRLAQIVAIAAASLPTAGA |
| Ga0207667_117921651 | 3300025949 | Corn Rhizosphere | MQQVAVLFRQARSRFGHRLAQLIAIAAASLPEAGA |
| Ga0207668_120167813 | 3300025972 | Switchgrass Rhizosphere | MRQVHSLLRGASSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207668_120506162 | 3300025972 | Switchgrass Rhizosphere | MRLVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207658_118869951 | 3300025986 | Switchgrass Rhizosphere | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPA |
| Ga0207678_103991682 | 3300026067 | Corn Rhizosphere | AHMEDEKMRQVRSLLSSASSRIGRRLSQIVAIAAASLPSAGA |
| Ga0207702_118772201 | 3300026078 | Corn Rhizosphere | EGIYDMRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAAGV |
| Ga0207641_101865772 | 3300026088 | Switchgrass Rhizosphere | MRQVQSLLRTTRLRIGRRLALIVAIAAASLPQAGA |
| Ga0207648_100338031 | 3300026089 | Miscanthus Rhizosphere | PPAHMEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPAVGA |
| Ga0207676_114970852 | 3300026095 | Switchgrass Rhizosphere | RRWKIEMRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207683_110413502 | 3300026121 | Miscanthus Rhizosphere | RWKIHKMQQVRSLLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0207683_117985032 | 3300026121 | Miscanthus Rhizosphere | MEDKEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPS |
| Ga0209838_10069651 | 3300026214 | Soil | MRHLRSLLRSAPSRIRRRLALIVAIAAASLPSAGA |
| Ga0209763_1131621 | 3300026227 | Upper Troposphere | MRQVQSLLRNAPARIGRRLAQIVAIAAASLPQAGA |
| Ga0209881_11171963 | 3300026273 | Soil | GIGDMRQLGLLLRSTRSRIGRRLALIVAIAAASLPAAGA |
| Ga0209438_10221502 | 3300026285 | Grasslands Soil | MRQVQSFLRNAPSRIGRRLAQIVAIAAASLPVAGA |
| Ga0209890_100947272 | 3300026291 | Soil | MRQVQSLLRTTRARIGRKLALIVAIAAASLPQAGA |
| Ga0209153_100036817 | 3300026312 | Soil | MRRINLLLRTTRSRIGRRLAEIVAIAAASLPGAGA |
| Ga0209471_11145791 | 3300026318 | Soil | MRQVRLLLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0209647_13507151 | 3300026319 | Grasslands Soil | CEMQQLRSLLRGAPSRIGRRLSQIVAIAAASLPAAGA |
| Ga0209375_12416221 | 3300026329 | Soil | HGRCQMREVGLLLRNAPSWIGRRLAQIVAIAAASLPAAGA |
| Ga0209056_102148182 | 3300026538 | Soil | MRKVGSLLRAAPSRIGRRLAQIVAIAAASLPHAGA |
| Ga0179593_11545894 | 3300026555 | Vadose Zone Soil | MRQLGSLLRSAPSRIGRRFAEIVAIAAASLPAAGA |
| Ga0179587_102025131 | 3300026557 | Vadose Zone Soil | MRRINSLLRTAPSLIRRRLAEIVAIAAASLPAAGA |
| Ga0179587_105993112 | 3300026557 | Vadose Zone Soil | MRQVQSFLRNALSRIGRRLAQIVAIAAASLPAAGA |
| Ga0179587_107031752 | 3300026557 | Vadose Zone Soil | MRQVTSFLLAAPSRIGRRLAQIVAIAAASLPAAGV |
| Ga0179587_108742251 | 3300026557 | Vadose Zone Soil | MQQLRSLLRSAPSRIGRRLSQIVAIAAASLPVAGA |
| Ga0208841_1048232 | 3300026721 | Soil | MRQLRSLLRTAPARIGRRFAQIVAIAAASLPSAGA |
| Ga0209906_1098772 | 3300026897 | Cyanobacterial | MRKVNSFLRSASSRIGRRLKLIVAIAAASLPSAGA |
| Ga0208099_10119422 | 3300027096 | Forest Soil | MKVMARLNALLRSTQSRIGRRLAEIVAIAAASLPAAG |
| Ga0208996_10712291 | 3300027257 | Forest Soil | MAQLKAMLRSAPSRIGRRLKLIVAIAAASLPAAGA |
| Ga0208996_10724371 | 3300027257 | Forest Soil | MRQLRSLLRTAPARIGRRLAQIVAIAAASLPSAGA |
| Ga0207780_10097214 | 3300027313 | Tropical Forest Soil | MAGMIDMRRLNSLLRSTRWRIGRRLAEIVAIAAASLPAAGV |
| Ga0209589_1000001683 | 3300027357 | Root Nodules | MMRQVQTLLRTAPAKIRRRFAQIVAIAAASLPQAGA |
| Ga0209213_100000134 | 3300027383 | Forest Soil | MRKFSSLLRSAPSRIGRRIALIVAIAAVSLPAAGA |
| Ga0208995_10196932 | 3300027388 | Forest Soil | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPTAGA |
| Ga0208993_10002929 | 3300027480 | Forest Soil | MRKFSSLLRSAPSRIGRRIALIVAIAAASLPSAGV |
| Ga0209735_11306721 | 3300027562 | Forest Soil | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPQAGA |
| Ga0209220_10114593 | 3300027587 | Forest Soil | MRQLNSLLRTTRSRIGRRLALIVAIAAASLPAAGA |
| Ga0209331_10021062 | 3300027603 | Forest Soil | MRQVTLLLRSVPSRIGRRLALIVAIAAASLPSAGV |
| Ga0209106_10004709 | 3300027616 | Forest Soil | MRKFSSLLRSAPSRIGRRIALIVAIAAASLPAAGA |
| Ga0209217_10149592 | 3300027651 | Forest Soil | MRKFSSLLRSAPSWIGRRLALIVAIAAASLPAAGA |
| Ga0208981_10123483 | 3300027669 | Forest Soil | MQDMQQVRSLLRDASSRIGRRLAQIVAIAAASLPVAGA |
| Ga0208981_10384542 | 3300027669 | Forest Soil | MRQVALLLRSVPSRIGRRLALIVAIAAASLPSAGV |
| Ga0209588_12762251 | 3300027671 | Vadose Zone Soil | MRQVGSLLRSAPSRIRRRLALIVAIAAASLPAAGA |
| Ga0209011_10041773 | 3300027678 | Forest Soil | MRQVGSFLRDAPSRIGRRLAQIVAIAIAAASLPAAGA |
| Ga0208991_10604002 | 3300027681 | Forest Soil | MQQLRSLLRGAPSRIGRRLSEIVAIAAASLPAAGA |
| Ga0209626_10076453 | 3300027684 | Forest Soil | MRQLQSLLRSAPSRIGRRFAEIVAIAAASLPAAGA |
| Ga0209626_10080955 | 3300027684 | Forest Soil | MRQLRSLLRSAPSRVRRRLAEIVAIAAASLPAAGA |
| Ga0209682_100041276 | 3300027716 | Wetland Sediment | MRQVGSLLRGASFRIGRRLSQIVAIAAASLPQAGA |
| Ga0208989_102475842 | 3300027738 | Forest Soil | QGIDDMRRISSLLRSAPSRIGRRLALIVAIAAASLPAAGA |
| Ga0209476_101786853 | 3300027802 | Activated Sludge | MRQLRSLLRAAPSRIGRRLKLIVAIAAASLPSAGA |
| Ga0209112_102112562 | 3300027817 | Forest Soil | MAHLNAILRSTRSRIGRRLAEIVAIAAASLPSAGV |
| Ga0209514_100586853 | 3300027819 | Groundwater | MRQLRSLLRSAPSRIGRRFALIVAIAAASLPSAGA |
| Ga0209813_102305162 | 3300027866 | Populus Endosphere | MDNEMRQVQQFLRKAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0209167_1000045419 | 3300027867 | Surface Soil | MRQLNALLRSTRSGIGRRLAEIVAIAAASLPAVGA |
| Ga0209023_100051765 | 3300027870 | Freshwater And Sediment | MQQIRSLLRGAPSRIGRRLSQIVAIAAASLPTAGA |
| Ga0209068_101422331 | 3300027894 | Watersheds | EGIRDMRQLSLLLRSAPSRIGRRLALILAIAAASLPAAGA |
| Ga0209068_105869742 | 3300027894 | Watersheds | MRQFRSLLRSTRSRIGRRLAEIVAIAAASLPAAGV |
| Ga0209624_105667212 | 3300027895 | Forest Soil | AGLKVMAHLNSLLRSFRSRMGSRLAQIVAIAAASLPAVGA |
| Ga0209067_100138246 | 3300027898 | Watersheds | MDMRPFHSLLRSTRSRIARRLAEIVAIAAASLPTAGA |
| Ga0209048_100491072 | 3300027902 | Freshwater Lake Sediment | MRQLHSLLHSAPARIGRRLAEIVAIAAESLPAAGA |
| Ga0209488_108809072 | 3300027903 | Vadose Zone Soil | MRQLRSLLRAAPSRIGRRLAQIVAIAAASLPEAGA |
| Ga0207428_103479842 | 3300027907 | Populus Rhizosphere | MRQVHSLLRGASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0209006_100092672 | 3300027908 | Forest Soil | MLQLRSLLRSAPSRVRRRLAEIVAIAAASLPAAGA |
| Ga0209006_104557822 | 3300027908 | Forest Soil | MRQFGSLLRSTRSRIARRLAQIVAIAAASLPAAGA |
| Ga0209069_102438341 | 3300027915 | Watersheds | MQRVRSLLRGVPFRFGRRLAQIVAIAAASLPAAGA |
| Ga0209526_100597702 | 3300028047 | Forest Soil | MRQLRSLLRAAPSRIGRRLAQIVAIAAASLAAAGV |
| Ga0209526_102129931 | 3300028047 | Forest Soil | MRQVTLLLRSVPPRIGRRLALIVAIAAASLPSAGV |
| Ga0268266_104226502 | 3300028379 | Switchgrass Rhizosphere | MRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA |
| Ga0268266_107156603 | 3300028379 | Switchgrass Rhizosphere | EMRQVATMLRAAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0268266_120813662 | 3300028379 | Switchgrass Rhizosphere | MEDKKMRQVRSLLSSASSRIARRFAQIVAIAAASLPAVGA |
| Ga0268266_123149412 | 3300028379 | Switchgrass Rhizosphere | MRQVQSYLRAAPARIGRRIAQIVAIAAASLPQAGA |
| Ga0268265_107190711 | 3300028380 | Switchgrass Rhizosphere | PPAHMEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0268265_125441812 | 3300028380 | Switchgrass Rhizosphere | MQKVGSLLRAAPSRIGRRLAQIVAIAAASLPHAGA |
| Ga0268264_10000048270 | 3300028381 | Switchgrass Rhizosphere | MRQVQSLLRTTRLRIGRKLALIVAIAAASLPQAGA |
| Ga0268264_106521022 | 3300028381 | Switchgrass Rhizosphere | PPAHMEDEEMRQVRSLLSSASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0137415_102100593 | 3300028536 | Vadose Zone Soil | MRQVTSFLRAAPSRIGRRLAQIVAIAAASLPAAGV |
| Ga0137415_106759502 | 3300028536 | Vadose Zone Soil | MRKVGSLLRAAPSRIGRRLAAIVAIAAASLADVGA |
| Ga0302153_100835892 | 3300028574 | Bog | MQKLRSLLRSTPSRIGRRLAEIVAIAAASLPSAGA |
| Ga0302202_103074422 | 3300028762 | Bog | MRQLRSLLRAAPSRIGRRLAEIVAIAAASLPAAGA |
| Ga0307517_101815232 | 3300028786 | Ectomycorrhiza | MEDEEMRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0307517_101847961 | 3300028786 | Ectomycorrhiza | MEDKDMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0307287_100277202 | 3300028796 | Soil | MEDEEMRQVRSLLSTASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0307292_104110782 | 3300028811 | Soil | FPVRPCPPAHMEDEGMRQVRSLLSTASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0307300_100187541 | 3300028880 | Soil | MRQVRSLLSTASSRIGRRLSLIVAIAAASLPSAGA |
| Ga0307300_102877562 | 3300028880 | Soil | MEDVQMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0302154_100376574 | 3300028882 | Bog | MQKFHALLRSAPRRIGRRLKLIVAIAAASLPSAGA |
| Ga0311362_112078262 | 3300029913 | Bog | GICPMRKLRSLLRLGPSRIGRRIAQVVAIAAASLPAAGA |
| Ga0311363_101206102 | 3300029922 | Fen | MQQLRTLLRSAPSRIGRRLALIVAIAAASLPGAGA |
| Ga0311346_105411561 | 3300029952 | Bog | KELEKMRQLRSLLRAAPSRIGRRLAEIVAIAAASLPAAGA |
| Ga0302298_101521002 | 3300029980 | Fen | MEDEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0311334_109320142 | 3300029987 | Fen | MQQVRKLLRDAPARIRRRLTQIVAIAAASLPAAGA |
| Ga0311365_113432652 | 3300029989 | Fen | GADGRCQMQKVRKLLRGAPARIGRRLAQIVAIAAASLPAAGA |
| Ga0311338_100790175 | 3300030007 | Palsa | MRQLGSLLSTAPSRIRRRLALIVAIAAASLPGAGA |
| Ga0302305_12871622 | 3300030046 | Palsa | MQQLTSLLRSARSRIGRRLSLIVAIAAASLPAAGA |
| Ga0311333_106019411 | 3300030114 | Fen | MQQVGSLLRSAPSRIRRRLALIVAIAAASLPSAGA |
| Ga0311349_101140564 | 3300030294 | Fen | MEAEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0311349_108723822 | 3300030294 | Fen | MQQVGSLLRSAPSRIRRRLALIVAIAAASLPAAGA |
| Ga0311360_106318802 | 3300030339 | Bog | MQKVRKLLRGAPARIGRRLAQIVAIAAASLPAAGA |
| Ga0311354_118992291 | 3300030618 | Palsa | GDMRQLGSFLGSASSRIRRRVALIVAIAAASLPAAGA |
| Ga0311335_100753022 | 3300030838 | Fen | MARKEIGNMRRLGSMLRSAPARIGRRFAQIVAIAAASLPSAGA |
| Ga0311335_112007682 | 3300030838 | Fen | MEAQEMRQVRSLLSSASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0308178_11441551 | 3300030990 | Soil | RMRQFGALLRSTRSRIGRRLADIVAIAAASLPAVGA |
| Ga0170834_1068260632 | 3300031057 | Forest Soil | MAQVRALLRAAPSRIGRRLAQIVAIAAASLPQAGA |
| Ga0170823_103445232 | 3300031128 | Forest Soil | MARLNALLSSTRSRIGHRLSQIVAIAAASLPAVGA |
| Ga0307501_100198411 | 3300031152 | Soil | MRKVGSLLRAAPSRIGRRLAAIVAIAAASLADAGA |
| Ga0307499_1000024513 | 3300031184 | Soil | MEDEEMRQVHSLLSSASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0170824_1096308482 | 3300031231 | Forest Soil | LLLGATGKREMRQVASLLRRAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0170824_1238255092 | 3300031231 | Forest Soil | PAPEENEMAQVRALLRTAPSRIGRKLAQIVAIAAASLPAAGA |
| Ga0302323_1005334152 | 3300031232 | Fen | MRQVQSLLRATRARIGRKLALIVAIAAASLPQAGA |
| Ga0265330_102392732 | 3300031235 | Rhizosphere | GMRRLRSLLRSAPSRVRRRLAEIVAIAAASLPAAGA |
| Ga0265325_104603981 | 3300031241 | Rhizosphere | GTGDMRKLGSLLRETPSRLRRRLAQIVAIAAASLPAAGA |
| Ga0265331_105368772 | 3300031250 | Rhizosphere | MQQIRSLLRGAPSRIGRRLSQIVAIAAASLPSVGA |
| Ga0307509_109765581 | 3300031507 | Ectomycorrhiza | MRQLRKLLRSAPSRIGRRLALIVAIAAESLPSAGA |
| Ga0310886_103407061 | 3300031562 | Soil | MRQVASWLRKAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0318573_108202971 | 3300031564 | Soil | MGRIRSFLQTTPARLRRRLAEIVAIAAASLPEAGA |
| Ga0307508_10000003165 | 3300031616 | Ectomycorrhiza | MQRVQSLLRSTRARIGRKLALIVAIAAVSLPDAGA |
| Ga0310686_1032503973 | 3300031708 | Soil | MQQFTSLLRSARSRIGRRLSLIVAIAAASLPAAGA |
| Ga0310686_1081562351 | 3300031708 | Soil | MAHLNTLLRSARSQIGNRLAQIVAIAAASLPAVGA |
| Ga0310686_1154658181 | 3300031708 | Soil | MRQLNALLRAAPSRIRRRVALIVAIAAASLPAAGA |
| Ga0265342_101956571 | 3300031712 | Rhizosphere | AGAEGTGDMRKLGSLLRETPSRLRRRLAQIVAIAAASLPAAGA |
| Ga0307474_102430722 | 3300031718 | Hardwood Forest Soil | MARLNALLRSTQSRLGQRLAEIVAIAAASLPTVGA |
| Ga0302321_1030127042 | 3300031726 | Fen | MQKVRKLLRGAPARIGRRLAEIVAIAAASLPAAGA |
| Ga0306918_102380892 | 3300031744 | Soil | MRNLNLLLRSARSRIGRRLAEIVAIAAASLPAAGV |
| Ga0318566_104877062 | 3300031779 | Soil | IDMRRLNSLLRSTRWRIGRRLAEIVAIAAASLPAAGV |
| Ga0302319_103651904 | 3300031788 | Bog | PARIWIGDMQKLRSLLRSTPSRIGRRLAEIVAIAAASLPSAGA |
| Ga0302319_118612142 | 3300031788 | Bog | MRQLNALLRSAPSRIGRRLALIVAIAAASLPAAGA |
| Ga0307478_100162463 | 3300031823 | Hardwood Forest Soil | MRHFSSLLRSTRAEIGRRLAQIVAIAAASLPAAGA |
| Ga0307413_100778983 | 3300031824 | Rhizosphere | MRQVRSLLRGASSRIGCRLSQIVAIAAASLPHAGA |
| Ga0307413_116121011 | 3300031824 | Rhizosphere | MEDEMRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAVGA |
| Ga0307410_103850992 | 3300031852 | Rhizosphere | MRKVRSLLSSASSRIARRLSEIVAIAAASLPAAGA |
| Ga0310904_112097832 | 3300031854 | Soil | MRQVHSLLRGASSRIGRRIAQIVAIAAASLPAAGA |
| Ga0310892_106426701 | 3300031858 | Soil | MEDEEMRQVRSFLRNAPSRIGRRLAQIVAIAAASLPVAGA |
| Ga0310900_116832661 | 3300031908 | Soil | KEMRQVRSLLSSASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0306923_104221553 | 3300031910 | Soil | VERVRSLLQQAPSRIRRRLAQIVAIAAASLPEAGA |
| Ga0307412_106649572 | 3300031911 | Rhizosphere | MEDEMRQVGSFLRNAPSRIGRRLAQIVAIAAASLPSAGA |
| Ga0307412_122471342 | 3300031911 | Rhizosphere | MEDSEMRQVGTFLRGAPSRIGRRLAQIVAIAAASLPVAGA |
| Ga0311367_103794591 | 3300031918 | Fen | LPHAPCPPAHMEDEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPDAGA |
| Ga0307409_1010957602 | 3300031995 | Rhizosphere | DHLRYAPCPPAHREDEEMRQVRSLLRGASSRIGCRLSQIVAIAAASLPHAGA |
| Ga0307416_1034363532 | 3300032002 | Rhizosphere | MKDEMRQVGTFLRNAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0308173_106904922 | 3300032074 | Soil | MEAEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPVAGA |
| Ga0310890_118188211 | 3300032075 | Soil | MEDEEMRQVRSLLSSTSSRIGRRLSQIVAIAAASLPAAGA |
| Ga0307415_1019328472 | 3300032126 | Rhizosphere | MRQIRSLLSSASSRIARRFAQIVAIAAASLPVAGA |
| Ga0307470_102901472 | 3300032174 | Hardwood Forest Soil | MQQVGSLLRGAPSRIGRRLAQIVAIAAASLPAAGA |
| Ga0307470_105083112 | 3300032174 | Hardwood Forest Soil | MEDYEMRQVHSLLRGASSRIGRRLAQIVAIAAASLPSAGA |
| Ga0307472_1000259221 | 3300032205 | Hardwood Forest Soil | MIDMRHLNSLLRSRRSRIGRRLAQIVAIAAASLPAAGA |
| Ga0307472_1003449162 | 3300032205 | Hardwood Forest Soil | MEDEEMRQVRSLLRGASSRIGRRLSQIVAIAAASLPSAGA |
| Ga0335082_106516911 | 3300032782 | Soil | MERVRSLLRAAPSRIRRRLAQIVAIAAASLPEAGA |
| Ga0335069_127770641 | 3300032893 | Soil | MARVRSFLQTTPARLRRRLAEIVAIAAASLPEAGV |
| Ga0335072_105175362 | 3300032898 | Soil | MQQVAVLLRKAPSRIGHRIAQLIAIAAASLPEVGA |
| Ga0335076_103512721 | 3300032955 | Soil | MRSLSSLLRSAPSRLRRRLVLIAEIAAASLPAAGA |
| Ga0310811_100084567 | 3300033475 | Soil | MQQVAMLLRKAPSRIGHRLSQLIAIAAASLPEVGA |
| Ga0310811_100730133 | 3300033475 | Soil | MQQVAFLLRKAPSRIAHRLSQLIAIAAASLPEVGA |
| Ga0310811_109457211 | 3300033475 | Soil | MRQVRSLLRGASSRIGRRLSQIVAIAAASLPSVGA |
| Ga0334847_003185_1100_1207 | 3300033826 | Soil | MRQISSMLRSAPARIGRRFAEIVAIAAASLPSAGA |
| Ga0370483_0134633_584_691 | 3300034124 | Untreated Peat Soil | MQQLSSLLRSIGSQIGRRLSLIVAIAAASLPGAGV |
| Ga0370486_041141_725_832 | 3300034126 | Untreated Peat Soil | MRQVRSFLRDASSRIGRRLSQIVAIAAASLPAAGA |
| Ga0370493_0288852_409_516 | 3300034129 | Untreated Peat Soil | MRQISSFLRSAPARIGRRFAEIVAIAAASLPAAGA |
| Ga0370502_0095126_92_199 | 3300034156 | Untreated Peat Soil | MRQVRSLLRDASSRIGRRLSQIVAIAAASLPAAGA |
| Ga0370480_0161114_128_235 | 3300034169 | Untreated Peat Soil | MRQVNSFLRSASSRIGRRFKLIVAIAAASLPSAGA |
| Ga0370545_084596_11_133 | 3300034643 | Soil | MEDEEMRQVRSLLSSASSRIGRRLALIVAIAAASLPSAGA |
| Ga0373948_0201005_19_126 | 3300034817 | Rhizosphere Soil | MRQVHSILRGASSRIGRRLAQIVAIAAASLPSAGA |
| ⦗Top⦘ |