


| Basic Information | |
|---|---|
| Family ID | F098177 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKPAGQQK |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.81 % |
| % of genes near scaffold ends (potentially truncated) | 26.92 % |
| % of genes from short scaffolds (< 2000 bps) | 82.69 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.192 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF07369 | DUF1488 | 7.69 |
| PF02798 | GST_N | 5.77 |
| PF00313 | CSD | 2.88 |
| PF07536 | HWE_HK | 1.92 |
| PF03401 | TctC | 0.96 |
| PF01177 | Asp_Glu_race | 0.96 |
| PF08546 | ApbA_C | 0.96 |
| PF02606 | LpxK | 0.96 |
| PF01402 | RHH_1 | 0.96 |
| PF06042 | NTP_transf_6 | 0.96 |
| PF13302 | Acetyltransf_3 | 0.96 |
| PF01165 | Ribosomal_S21 | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF01717 | Meth_synt_2 | 0.96 |
| PF04909 | Amidohydro_2 | 0.96 |
| PF08125 | Mannitol_dh_C | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| PF00487 | FA_desaturase | 0.96 |
| PF01841 | Transglut_core | 0.96 |
| PF02515 | CoA_transf_3 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.92 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 1.92 |
| COG0246 | Mannitol-1-phosphate/altronate dehydrogenases | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.96 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.96 |
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.96 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.96 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.96 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3575 | Uncharacterized conserved protein | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.15 % |
| Unclassified | root | N/A | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01DFRJ0 | Not Available | 596 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101668911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2884 | Open in IMG/M |
| 3300000956|JGI10216J12902_106372356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5302 | Open in IMG/M |
| 3300000956|JGI10216J12902_111065599 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300001661|JGI12053J15887_10180227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1087 | Open in IMG/M |
| 3300001686|C688J18823_10463559 | Not Available | 815 | Open in IMG/M |
| 3300002074|JGI24748J21848_1018445 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300002077|JGI24744J21845_10016025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1494 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101449845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300002568|C688J35102_119132217 | Not Available | 643 | Open in IMG/M |
| 3300002568|C688J35102_120162860 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300003324|soilH2_10229178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2591 | Open in IMG/M |
| 3300004114|Ga0062593_100164192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1709 | Open in IMG/M |
| 3300004153|Ga0063455_100058052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1370 | Open in IMG/M |
| 3300004157|Ga0062590_100499262 | Not Available | 1036 | Open in IMG/M |
| 3300004463|Ga0063356_100193613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2387 | Open in IMG/M |
| 3300004479|Ga0062595_100807882 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300004479|Ga0062595_101932771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300004480|Ga0062592_100472732 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300004480|Ga0062592_100499928 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300004643|Ga0062591_100021885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3129 | Open in IMG/M |
| 3300005093|Ga0062594_100089552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1786 | Open in IMG/M |
| 3300005093|Ga0062594_103175838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 515 | Open in IMG/M |
| 3300005338|Ga0068868_100766617 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005356|Ga0070674_101424950 | Not Available | 621 | Open in IMG/M |
| 3300005367|Ga0070667_100496157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
| 3300005511|Ga0077121_10404869 | Not Available | 952 | Open in IMG/M |
| 3300005529|Ga0070741_10251159 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300005564|Ga0070664_100517422 | Not Available | 1101 | Open in IMG/M |
| 3300005575|Ga0066702_10466104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300005587|Ga0066654_10412655 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005841|Ga0068863_102731248 | Not Available | 502 | Open in IMG/M |
| 3300006038|Ga0075365_10520626 | Not Available | 841 | Open in IMG/M |
| 3300006042|Ga0075368_10352058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 641 | Open in IMG/M |
| 3300009143|Ga0099792_10488036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300009174|Ga0105241_12184530 | Not Available | 549 | Open in IMG/M |
| 3300009553|Ga0105249_11289774 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009553|Ga0105249_13339033 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010045|Ga0126311_11653207 | Not Available | 540 | Open in IMG/M |
| 3300010052|Ga0133944_1001186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 60665 | Open in IMG/M |
| 3300010397|Ga0134124_11985400 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010399|Ga0134127_13292174 | Not Available | 528 | Open in IMG/M |
| 3300010400|Ga0134122_12308637 | Not Available | 584 | Open in IMG/M |
| 3300012212|Ga0150985_114730412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
| 3300012212|Ga0150985_121963229 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012469|Ga0150984_113876647 | Not Available | 597 | Open in IMG/M |
| 3300012683|Ga0137398_10206993 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300012882|Ga0157304_1067675 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012892|Ga0157294_10114486 | Not Available | 710 | Open in IMG/M |
| 3300012896|Ga0157303_10045378 | Not Available | 878 | Open in IMG/M |
| 3300012901|Ga0157288_10057335 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300012913|Ga0157298_10011441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1493 | Open in IMG/M |
| 3300012924|Ga0137413_10229389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1264 | Open in IMG/M |
| 3300012927|Ga0137416_10065573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2611 | Open in IMG/M |
| 3300012930|Ga0137407_11404810 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012957|Ga0164303_11345773 | Not Available | 531 | Open in IMG/M |
| 3300012958|Ga0164299_11005868 | Not Available | 615 | Open in IMG/M |
| 3300013297|Ga0157378_12801958 | Not Available | 540 | Open in IMG/M |
| 3300014325|Ga0163163_10678009 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300014968|Ga0157379_11046815 | Not Available | 780 | Open in IMG/M |
| 3300015372|Ga0132256_100528704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1291 | Open in IMG/M |
| 3300015372|Ga0132256_102914942 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015373|Ga0132257_100847530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
| 3300015373|Ga0132257_103014066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp. | 613 | Open in IMG/M |
| 3300017792|Ga0163161_11728834 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300017965|Ga0190266_10516303 | Not Available | 700 | Open in IMG/M |
| 3300018067|Ga0184611_1277316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300018073|Ga0184624_10314649 | Not Available | 701 | Open in IMG/M |
| 3300018432|Ga0190275_10003292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11505 | Open in IMG/M |
| 3300018432|Ga0190275_10005268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9309 | Open in IMG/M |
| 3300018469|Ga0190270_10761929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 969 | Open in IMG/M |
| 3300018469|Ga0190270_11022024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300018469|Ga0190270_12690646 | Not Available | 560 | Open in IMG/M |
| 3300018476|Ga0190274_10699679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1057 | Open in IMG/M |
| 3300019361|Ga0173482_10007344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2683 | Open in IMG/M |
| 3300019883|Ga0193725_1111844 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300019884|Ga0193741_1037488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1251 | Open in IMG/M |
| 3300020005|Ga0193697_1092016 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300021170|Ga0210400_10583834 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300021363|Ga0193699_10029025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2062 | Open in IMG/M |
| 3300022756|Ga0222622_10056813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2237 | Open in IMG/M |
| 3300022883|Ga0247786_1131272 | Not Available | 556 | Open in IMG/M |
| 3300023064|Ga0247801_1029822 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300024347|Ga0179591_1023853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2340 | Open in IMG/M |
| 3300025899|Ga0207642_10043037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300025930|Ga0207701_10237020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1595 | Open in IMG/M |
| 3300025937|Ga0207669_11096034 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025937|Ga0207669_11587292 | Not Available | 558 | Open in IMG/M |
| 3300026078|Ga0207702_12145573 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026088|Ga0207641_12495667 | Not Available | 515 | Open in IMG/M |
| 3300026089|Ga0207648_11418156 | Not Available | 653 | Open in IMG/M |
| 3300026863|Ga0209902_102680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4665 | Open in IMG/M |
| 3300027266|Ga0209215_1059848 | Not Available | 532 | Open in IMG/M |
| 3300027603|Ga0209331_1071412 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027907|Ga0207428_10696663 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300028536|Ga0137415_10107297 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300028810|Ga0307294_10375228 | Not Available | 530 | Open in IMG/M |
| 3300030988|Ga0308183_1192945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300031456|Ga0307513_10132765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2432 | Open in IMG/M |
| 3300031720|Ga0307469_11672863 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031720|Ga0307469_11770550 | Not Available | 596 | Open in IMG/M |
| 3300032782|Ga0335082_10115082 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300033004|Ga0335084_10077958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3435 | Open in IMG/M |
| 3300034155|Ga0370498_015090 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 8.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Liquid | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Cyanobacterial | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010052 | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026863 | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_02208770 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MSNENDKSVAPGTTKADPANNQPAPQQNQGGAKPGSNKPADQQK |
| INPhiseqgaiiFebDRAFT_1016689115 | 3300000364 | Soil | MNTENQKPVAPGTTKVEPANAQPAPQQNQGDAKPSTEKPAGQQK* |
| JGI10216J12902_1063723564 | 3300000956 | Soil | MSNENQKPVAPGTTKIDPAQTQQPVPQQNQGDNKPGTEKPAEQQK* |
| JGI10216J12902_1110655992 | 3300000956 | Soil | MSNETQKPVAPGTTKVEPATAPAPQQNQGDVKPGTEKPADQQK* |
| JGI12053J15887_101802271 | 3300001661 | Forest Soil | MTNETEKPVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK* |
| C688J18823_104635593 | 3300001686 | Soil | MTNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK* |
| JGI24748J21848_10184452 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDK |
| JGI24744J21845_100160252 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQXK* |
| JGIcombinedJ26739_1014498451 | 3300002245 | Forest Soil | MKGFYLMTNETQKPVAPGTTKVEPAVSPAPQQNQGDAKPSADKPANQQQK* |
| C688J35102_1191322172 | 3300002568 | Soil | MTNETQKPVAPGTTKVEPAAVQPAPQQNQGDAKPSTDKPAAQQK* |
| C688J35102_1201628602 | 3300002568 | Soil | MSTENHNTVAPGTTKVEPANTHPAPQQNQGDAKPSTEKPASQQK* |
| soilH2_102291784 | 3300003324 | Sugarcane Root And Bulk Soil | MSNENQKPVAPGTTKTDPAQGQPAPQQNQGDNKAGADKPAGQQK* |
| Ga0062593_1001641922 | 3300004114 | Soil | MSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQQK* |
| Ga0063455_1000580522 | 3300004153 | Soil | MSTENQKPVAPGTTNVEPANTHPAPQQNQGDAKPSTEKPAGQQK* |
| Ga0062590_1004992623 | 3300004157 | Soil | VSNENQKSVTPDTKVEPATAQPAPQQSQADAKPSTDQAAGQKK* |
| Ga0063356_1001936135 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGTDKPANQQQK* |
| Ga0062595_1008078822 | 3300004479 | Soil | MSTENQKPVAPGTTKVEPANVQPAPQQNQGDAKPSTDKPAGQQK* |
| Ga0062595_1019327711 | 3300004479 | Soil | ENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSADKPASQQK* |
| Ga0062592_1004727321 | 3300004480 | Soil | VSNENQKSVTPDTKVEPATAQPAPQQSQADAKPGTDQAAGQKK* |
| Ga0062592_1004999282 | 3300004480 | Soil | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK* |
| Ga0062591_1000218851 | 3300004643 | Soil | ENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0062594_1000895526 | 3300005093 | Soil | MNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0062594_1031758382 | 3300005093 | Soil | TENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK* |
| Ga0068868_1007666171 | 3300005338 | Miscanthus Rhizosphere | MNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0070674_1014249501 | 3300005356 | Miscanthus Rhizosphere | MSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPADQQK* |
| Ga0070667_1004961571 | 3300005367 | Switchgrass Rhizosphere | MTNETEKTVAPGTTKVEPAVTPTPQQNQGDAKPSADKPANQQQK* |
| Ga0077121_104048692 | 3300005511 | Arabidopsis Rhizosphere | MTNETEKTVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK* |
| Ga0070741_102511593 | 3300005529 | Surface Soil | MSNENDKSVAPGTTKADPANNQPAPQQNQGGAKPGSNKPADQQK* |
| Ga0070664_1005174223 | 3300005564 | Corn Rhizosphere | AQGIHKMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0066702_104661041 | 3300005575 | Soil | MTNETQKPVAPGSTHVEPAKSPAPQQTQGDAKPSADKSAQQK* |
| Ga0066654_104126552 | 3300005587 | Soil | VSNENQKPVAPGTTKVEPATAQPAPQQNQGDAKPSTDKPAVQQK* |
| Ga0068863_1027312482 | 3300005841 | Switchgrass Rhizosphere | MNNENQKPVSADTTKVEPAKAQPQQNQGDGKPGTGKPAEQ |
| Ga0075365_105206263 | 3300006038 | Populus Endosphere | ENQKPVAPGTTTVEPNKTTPAPQQNQGDAKPSTDKPAGQQK* |
| Ga0075368_103520581 | 3300006042 | Populus Endosphere | MSNENQKPVAPGTTTVEPNKTTPAPQQNQGDAKPSTDKPAGQQK* |
| Ga0099792_104880362 | 3300009143 | Vadose Zone Soil | MSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPSTDKPADQQK* |
| Ga0105241_121845302 | 3300009174 | Corn Rhizosphere | MSNESQKNAPGTTKVDPANTQPPQQQNQGDGTPNSEKPANQQK* |
| Ga0105249_112897742 | 3300009553 | Switchgrass Rhizosphere | MAYLENAFRSFHEGIYFMTNETEKTVAPGTTKVEPAVTPTPQQNQGDAKPSADKPANQQQK* |
| Ga0105249_133390332 | 3300009553 | Switchgrass Rhizosphere | MSNETQKPVAHGTTTVEPANAQPAPQQNQGDSKPSTDKPAEQQK* |
| Ga0126311_116532072 | 3300010045 | Serpentine Soil | MSNEAQKPVAPGTTKVEPNAQPQQQNQGDAKPSTDKPDAQQK* |
| Ga0133944_100118645 | 3300010052 | Liquid | MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK* |
| Ga0134124_119854001 | 3300010397 | Terrestrial Soil | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDGKPSADKPASQ |
| Ga0134127_132921741 | 3300010399 | Terrestrial Soil | MLLGLFMKGFHHMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK* |
| Ga0134122_123086372 | 3300010400 | Terrestrial Soil | MSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPAGQQK* |
| Ga0150985_1147304122 | 3300012212 | Avena Fatua Rhizosphere | RVLVRSLMPNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK* |
| Ga0150985_1219632291 | 3300012212 | Avena Fatua Rhizosphere | MTNETQKPVAPGTTKVEPAAVQPAPQQNQGDAKTDKPAAQQK* |
| Ga0150984_1138766472 | 3300012469 | Avena Fatua Rhizosphere | YEGIYLMTNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK* |
| Ga0137398_102069934 | 3300012683 | Vadose Zone Soil | MSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPSTDK |
| Ga0157304_10676752 | 3300012882 | Soil | MNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQ |
| Ga0157294_101144862 | 3300012892 | Soil | MNNENQKPAAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0157303_100453783 | 3300012896 | Soil | FAQGIHKMNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK* |
| Ga0157288_100573351 | 3300012901 | Soil | HQKPVAPGTTKVEPATVQPTPQQNQGDSKPSTDKPAEQQK* |
| Ga0157298_100114412 | 3300012913 | Soil | MSNETQKPVAPGTTKVEPAAPQATPQQNQGDAKPSTDKPAEQQK* |
| Ga0137413_102293891 | 3300012924 | Vadose Zone Soil | MTNETEKPVAPGTTKVEPAVTPAPQQNQGDAKPAADKPANQQQK* |
| Ga0137416_100655732 | 3300012927 | Vadose Zone Soil | MTNETPTPVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK* |
| Ga0137407_114048102 | 3300012930 | Vadose Zone Soil | MTNETPTPVAPGTTKVEPAATPTPQQNQGDAKPSADKPANQQQK* |
| Ga0164303_113457731 | 3300012957 | Soil | MTNEPQTSAPGTTKVDPANKQPPQQQNQGDGKPGSEKPANQQK* |
| Ga0164299_110058682 | 3300012958 | Soil | VSNENQKSVTPDTKVEPATAQPAPQQSHADAKPSTDQAAGQKK* |
| Ga0157378_128019581 | 3300013297 | Miscanthus Rhizosphere | MTNENQKPAAPGTTRVEPVKSPVPQQTQGDAKPATEKPAGQQK* |
| Ga0163163_106780091 | 3300014325 | Switchgrass Rhizosphere | MSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKPSTDKPAEQQK* |
| Ga0157379_110468152 | 3300014968 | Switchgrass Rhizosphere | MFLGFSERIDAMSNENQKPVAPGTTKADPANAQPAPQHNQGNPKPGADKPGSQQK* |
| Ga0132256_1005287042 | 3300015372 | Arabidopsis Rhizosphere | MFLGLSRQGFIKMSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGTDKPANQQQK* |
| Ga0132256_1029149422 | 3300015372 | Arabidopsis Rhizosphere | MTNENQKPVAPGTSKVDPAQAQPAPQQNQGGSKPGTDKPAS |
| Ga0132257_1008475301 | 3300015373 | Arabidopsis Rhizosphere | MKMSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGSDKPANQQQK* |
| Ga0132257_1030140661 | 3300015373 | Arabidopsis Rhizosphere | ENQKPVAPETKVEPTTGQPAQQQNQGDAKQNADKSGGQQK* |
| Ga0163161_117288342 | 3300017792 | Switchgrass Rhizosphere | MSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKQGTDKPASQ |
| Ga0190266_105163031 | 3300017965 | Soil | VAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK |
| Ga0184611_12773161 | 3300018067 | Groundwater Sediment | MTNETQKPVAPGTTKVEPTAQPTPQQNQGDAKPSTDKPADQQK |
| Ga0184624_103146491 | 3300018073 | Groundwater Sediment | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK |
| Ga0190275_100032927 | 3300018432 | Soil | MSNENQKPVAPGTTKVDPAQTPQPAPQQTQGDSKPGADKPADQQK |
| Ga0190275_100052683 | 3300018432 | Soil | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKPAGQQK |
| Ga0190270_107619293 | 3300018469 | Soil | MTNENQKPVAPGTTKVEPAHAQPATPQQNQGDSKPATEKPAEQQ |
| Ga0190270_110220243 | 3300018469 | Soil | MSNENQKPVAPGTTKVEPAHAQPATPQQNQGDSKPATEKPAEQQK |
| Ga0190270_126906461 | 3300018469 | Soil | MTTENQKPVAPGTTKVEPATAQPAPQQNQGDAKPSTEKPAGQQK |
| Ga0190274_106996792 | 3300018476 | Soil | MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKSAGQQK |
| Ga0173482_100073446 | 3300019361 | Soil | MNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK |
| Ga0193725_11118441 | 3300019883 | Soil | MTNEAQKPVVAPGTTHVEPAKSPAPQQNQGDAKPSTDK |
| Ga0193741_10374882 | 3300019884 | Soil | MTNETQKPVAPGTTKVEPANAQPAPQQNQGDAKPDSDKPAQQK |
| Ga0193697_10920162 | 3300020005 | Soil | MTNETEKHVAPGTTKVEPAVTPTPQQSQGDAKPSADKPAEQQK |
| Ga0210400_105838341 | 3300021170 | Soil | MKGFCLMTNETLKPVAPGTTKVDPAITPAPQQNQGDAKPSADKPANQQQK |
| Ga0193699_100290254 | 3300021363 | Soil | MKGFYLMTNETPTPVAPGTTKVEPAVTPTPQQNQGDAKPAADKPANQQQK |
| Ga0222622_100568136 | 3300022756 | Groundwater Sediment | MSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQQK |
| Ga0247786_11312722 | 3300022883 | Soil | MNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK |
| Ga0247801_10298221 | 3300023064 | Soil | MNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAG |
| Ga0179591_10238532 | 3300024347 | Vadose Zone Soil | MTNETQKPVAPGTTKVEPAVTPTPQQNQGDAKPSADKPADQQQK |
| Ga0207642_100430372 | 3300025899 | Miscanthus Rhizosphere | MSNETQKPVAPGTTKVEPANAPAPQQNQGDAKPNTDKPAGQQK |
| Ga0207701_102370201 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDK |
| Ga0207669_110960342 | 3300025937 | Miscanthus Rhizosphere | MSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKQGTDKPASQQK |
| Ga0207669_115872921 | 3300025937 | Miscanthus Rhizosphere | SFHEGIHQMSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPNTDKPAGQQK |
| Ga0207702_121455731 | 3300026078 | Corn Rhizosphere | MSNEAQKSVAPGTTKVEPANTQTTPQQNQGGGKPDADKPSDQQK |
| Ga0207641_124956672 | 3300026088 | Switchgrass Rhizosphere | MNNENQKPVSADTTKVEPAKAQPQQNQGDGKPGTGKPAEQQK |
| Ga0207648_114181561 | 3300026089 | Miscanthus Rhizosphere | MSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPADQQK |
| Ga0209902_1026807 | 3300026863 | Cyanobacterial | MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK |
| Ga0209215_10598482 | 3300027266 | Forest Soil | MSNENQKPVAPGATEVDPAQTQQPAPQQTQGDSKPSTDKPAQQK |
| Ga0209331_10714121 | 3300027603 | Forest Soil | MKGFYLMTNETQKPVAPGTTKVEPAVSPAPQQNQGDAKPSADKPANQQQK |
| Ga0207428_106966631 | 3300027907 | Populus Rhizosphere | MSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTD |
| Ga0137415_101072974 | 3300028536 | Vadose Zone Soil | GISQMSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPRTDKPADQQK |
| Ga0307294_103752281 | 3300028810 | Soil | MTNEAQKPVAPGTTKVEPAAAQPAPQQNQGDAKPSTDKPAAQQK |
| Ga0308183_11929452 | 3300030988 | Soil | MTNENQKSVAPGTTKVEPAVAQPAPQQNQGDAKPSTDKPAAQQK |
| Ga0307513_101327651 | 3300031456 | Ectomycorrhiza | MTNETEKTVAPGTTKVEPAATPTPQQNQGDAKPSADKPANQQQK |
| Ga0307469_116728632 | 3300031720 | Hardwood Forest Soil | MTNETQKPVVAPGTTHVEPAKSPAPQQNQGDAKPSTEKPAGQQK |
| Ga0307469_117705501 | 3300031720 | Hardwood Forest Soil | MSNENQKPVAPGTTKSDPAQTQPAPQQSQGDSKPGVDKPTDQQK |
| Ga0335082_101150826 | 3300032782 | Soil | MSNENQKPAAPGTTKSGQASTQPPAQQNQGDAKSGSKPADQQK |
| Ga0335084_100779583 | 3300033004 | Soil | MSNENQKPVAPGTTKSGQANTQPPAQQNQGDAKSGSKPADQQK |
| Ga0370498_015090_1263_1400 | 3300034155 | Untreated Peat Soil | MSNENQKPVAPGTTKVDPAQTPQPAPQQTQGDNKPSTDKPAEQQK |
| ⦗Top⦘ |