


| Basic Information | |
|---|---|
| Family ID | F008003 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 341 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML |
| Number of Associated Samples | 208 |
| Number of Associated Scaffolds | 341 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.92 % |
| % of genes near scaffold ends (potentially truncated) | 44.87 % |
| % of genes from short scaffolds (< 2000 bps) | 86.80 % |
| Associated GOLD sequencing projects | 193 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.900 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.437 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.560 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 341 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 2.05 |
| PF00528 | BPD_transp_1 | 1.76 |
| PF07221 | GlcNAc_2-epim | 1.47 |
| PF02653 | BPD_transp_2 | 1.47 |
| PF14224 | DUF4331 | 1.17 |
| PF02683 | DsbD | 1.17 |
| PF00005 | ABC_tran | 0.88 |
| PF00370 | FGGY_N | 0.88 |
| PF00550 | PP-binding | 0.88 |
| PF12399 | BCA_ABC_TP_C | 0.88 |
| PF04955 | HupE_UreJ | 0.88 |
| PF08808 | RES | 0.88 |
| PF13458 | Peripla_BP_6 | 0.88 |
| PF01578 | Cytochrom_C_asm | 0.88 |
| PF01063 | Aminotran_4 | 0.59 |
| PF03480 | DctP | 0.59 |
| PF01494 | FAD_binding_3 | 0.59 |
| PF00009 | GTP_EFTU | 0.59 |
| PF01370 | Epimerase | 0.59 |
| PF00497 | SBP_bac_3 | 0.59 |
| PF00571 | CBS | 0.59 |
| PF00696 | AA_kinase | 0.59 |
| PF01713 | Smr | 0.59 |
| PF00557 | Peptidase_M24 | 0.59 |
| PF04828 | GFA | 0.59 |
| PF12697 | Abhydrolase_6 | 0.59 |
| PF14588 | YjgF_endoribonc | 0.59 |
| PF00293 | NUDIX | 0.59 |
| PF00583 | Acetyltransf_1 | 0.59 |
| PF00903 | Glyoxalase | 0.59 |
| PF00486 | Trans_reg_C | 0.59 |
| PF13467 | RHH_4 | 0.59 |
| PF07883 | Cupin_2 | 0.59 |
| PF07690 | MFS_1 | 0.59 |
| PF00033 | Cytochrome_B | 0.59 |
| PF01734 | Patatin | 0.59 |
| PF01609 | DDE_Tnp_1 | 0.59 |
| PF08402 | TOBE_2 | 0.59 |
| PF02913 | FAD-oxidase_C | 0.59 |
| PF03734 | YkuD | 0.59 |
| PF01925 | TauE | 0.29 |
| PF01796 | OB_aCoA_assoc | 0.29 |
| PF05193 | Peptidase_M16_C | 0.29 |
| PF00501 | AMP-binding | 0.29 |
| PF01436 | NHL | 0.29 |
| PF09334 | tRNA-synt_1g | 0.29 |
| PF13953 | PapC_C | 0.29 |
| PF05683 | Fumerase_C | 0.29 |
| PF01019 | G_glu_transpept | 0.29 |
| PF02699 | YajC | 0.29 |
| PF01636 | APH | 0.29 |
| PF00156 | Pribosyltran | 0.29 |
| PF01522 | Polysacc_deac_1 | 0.29 |
| PF02771 | Acyl-CoA_dh_N | 0.29 |
| PF13545 | HTH_Crp_2 | 0.29 |
| PF01262 | AlaDh_PNT_C | 0.29 |
| PF01909 | NTP_transf_2 | 0.29 |
| PF01149 | Fapy_DNA_glyco | 0.29 |
| PF00939 | Na_sulph_symp | 0.29 |
| PF01970 | TctA | 0.29 |
| PF00762 | Ferrochelatase | 0.29 |
| PF11794 | HpaB_N | 0.29 |
| PF01678 | DAP_epimerase | 0.29 |
| PF01053 | Cys_Met_Meta_PP | 0.29 |
| PF00691 | OmpA | 0.29 |
| PF13147 | Obsolete Pfam Family | 0.29 |
| PF01266 | DAO | 0.29 |
| PF00857 | Isochorismatase | 0.29 |
| PF04976 | DmsC | 0.29 |
| PF13249 | SQHop_cyclase_N | 0.29 |
| PF00709 | Adenylsucc_synt | 0.29 |
| PF01728 | FtsJ | 0.29 |
| PF13193 | AMP-binding_C | 0.29 |
| PF14310 | Fn3-like | 0.29 |
| PF01425 | Amidase | 0.29 |
| PF04963 | Sigma54_CBD | 0.29 |
| PF03358 | FMN_red | 0.29 |
| PF00587 | tRNA-synt_2b | 0.29 |
| PF02558 | ApbA | 0.29 |
| PF00381 | PTS-HPr | 0.29 |
| PF00364 | Biotin_lipoyl | 0.29 |
| PF13662 | Toprim_4 | 0.29 |
| PF13847 | Methyltransf_31 | 0.29 |
| PF12096 | DUF3572 | 0.29 |
| PF02878 | PGM_PMM_I | 0.29 |
| PF04055 | Radical_SAM | 0.29 |
| PF01656 | CbiA | 0.29 |
| PF00535 | Glycos_transf_2 | 0.29 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.29 |
| PF00011 | HSP20 | 0.29 |
| PF02541 | Ppx-GppA | 0.29 |
| PF11799 | IMS_C | 0.29 |
| PF09312 | SurA_N | 0.29 |
| PF05731 | TROVE | 0.29 |
| PF01926 | MMR_HSR1 | 0.29 |
| PF12098 | DUF3574 | 0.29 |
| PF07995 | GSDH | 0.29 |
| PF04964 | Flp_Fap | 0.29 |
| PF00313 | CSD | 0.29 |
| PF02749 | QRPTase_N | 0.29 |
| PF13641 | Glyco_tranf_2_3 | 0.29 |
| PF07021 | MetW | 0.29 |
| PF04339 | FemAB_like | 0.29 |
| PF02082 | Rrf2 | 0.29 |
| PF00462 | Glutaredoxin | 0.29 |
| PF12704 | MacB_PCD | 0.29 |
| PF01783 | Ribosomal_L32p | 0.29 |
| PF13807 | GNVR | 0.29 |
| PF03960 | ArsC | 0.29 |
| PF02686 | Glu-tRNAGln | 0.29 |
| PF02569 | Pantoate_ligase | 0.29 |
| PF09285 | Elong-fact-P_C | 0.29 |
| PF02515 | CoA_transf_3 | 0.29 |
| PF07977 | FabA | 0.29 |
| PF04377 | ATE_C | 0.29 |
| PF05118 | Asp_Arg_Hydrox | 0.29 |
| PF12200 | DUF3597 | 0.29 |
| PF00719 | Pyrophosphatase | 0.29 |
| PF02211 | NHase_beta | 0.29 |
| PF00120 | Gln-synt_C | 0.29 |
| PF00456 | Transketolase_N | 0.29 |
| PF13432 | TPR_16 | 0.29 |
| PF01564 | Spermine_synth | 0.29 |
| PF07372 | DUF1491 | 0.29 |
| PF00275 | EPSP_synthase | 0.29 |
| PF01041 | DegT_DnrJ_EryC1 | 0.29 |
| PF03167 | UDG | 0.29 |
| PF01738 | DLH | 0.29 |
| PF03454 | MoeA_C | 0.29 |
| PF01322 | Cytochrom_C_2 | 0.29 |
| PF04107 | GCS2 | 0.29 |
| PF05050 | Methyltransf_21 | 0.29 |
| PF14579 | HHH_6 | 0.29 |
| PF02954 | HTH_8 | 0.29 |
| PF00180 | Iso_dh | 0.29 |
| PF00749 | tRNA-synt_1c | 0.29 |
| PF03631 | Virul_fac_BrkB | 0.29 |
| PF00330 | Aconitase | 0.29 |
| PF04126 | Cyclophil_like | 0.29 |
| PF07309 | FlaF | 0.29 |
| PF13649 | Methyltransf_25 | 0.29 |
| PF01503 | PRA-PH | 0.29 |
| PF02230 | Abhydrolase_2 | 0.29 |
| PF00753 | Lactamase_B | 0.29 |
| PF03602 | Cons_hypoth95 | 0.29 |
| PF01192 | RNA_pol_Rpb6 | 0.29 |
| PF01988 | VIT1 | 0.29 |
| PF04073 | tRNA_edit | 0.29 |
| PF01070 | FMN_dh | 0.29 |
| PF03306 | AAL_decarboxy | 0.29 |
| PF13577 | SnoaL_4 | 0.29 |
| PF00977 | His_biosynth | 0.29 |
| PF14087 | DUF4267 | 0.29 |
| PF12833 | HTH_18 | 0.29 |
| PF00543 | P-II | 0.29 |
| PF03711 | OKR_DC_1_C | 0.29 |
| PF06155 | GBBH-like_N | 0.29 |
| PF04390 | LptE | 0.29 |
| PF00861 | Ribosomal_L18p | 0.29 |
| PF01144 | CoA_trans | 0.29 |
| PF01321 | Creatinase_N | 0.29 |
| PF07100 | ASRT | 0.29 |
| PF00496 | SBP_bac_5 | 0.29 |
| PF00534 | Glycos_transf_1 | 0.29 |
| PF00793 | DAHP_synth_1 | 0.29 |
| PF05598 | DUF772 | 0.29 |
| PF01710 | HTH_Tnp_IS630 | 0.29 |
| PF00892 | EamA | 0.29 |
| PF09084 | NMT1 | 0.29 |
| PF09722 | Xre_MbcA_ParS_C | 0.29 |
| PF02826 | 2-Hacid_dh_C | 0.29 |
| PF05974 | DUF892 | 0.29 |
| PF00160 | Pro_isomerase | 0.29 |
| PF00664 | ABC_membrane | 0.29 |
| PF03328 | HpcH_HpaI | 0.29 |
| PF00296 | Bac_luciferase | 0.29 |
| PF14748 | P5CR_dimer | 0.29 |
| PF12002 | MgsA_C | 0.29 |
| PF03453 | MoeA_N | 0.29 |
| PF01025 | GrpE | 0.29 |
| PF03379 | CcmB | 0.29 |
| PF03330 | DPBB_1 | 0.29 |
| PF07813 | LTXXQ | 0.29 |
| PF00361 | Proton_antipo_M | 0.29 |
| PF01812 | 5-FTHF_cyc-lig | 0.29 |
| PF13434 | Lys_Orn_oxgnase | 0.29 |
| PF00132 | Hexapep | 0.29 |
| PF07366 | SnoaL | 0.29 |
| PF01583 | APS_kinase | 0.29 |
| PF03466 | LysR_substrate | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 341 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.05 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 1.47 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.17 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.17 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.88 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 0.59 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.59 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.59 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.59 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.59 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.59 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.59 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.59 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.59 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.59 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.59 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.59 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.59 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.59 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.59 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.59 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.59 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.59 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.29 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.29 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.29 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.29 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.29 |
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 0.29 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.29 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.29 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0333 | Ribosomal protein L32 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.29 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.29 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.29 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.29 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.29 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.29 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.29 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.29 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.29 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.29 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.29 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.29 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.29 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.29 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.29 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.29 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.29 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.29 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.29 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.29 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.29 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.29 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.29 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.29 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.29 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.29 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.29 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.29 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.29 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.29 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.29 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.29 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.29 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.29 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.29 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG3146 | Predicted N-acyltransferase | General function prediction only [R] | 0.29 |
| COG3302 | DMSO reductase anchor subunit DmsC | Energy production and conversion [C] | 0.29 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.29 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.29 |
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.29 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.29 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.29 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.29 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.29 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.29 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.29 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.29 |
| COG4288 | Uncharacterized conserved protein | Function unknown [S] | 0.29 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.29 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.29 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.29 |
| COG5442 | Flagellar biosynthesis regulator FlaF | Cell motility [N] | 0.29 |
| COG5447 | Uncharacterized conserved protein, DUF1491 domain | Function unknown [S] | 0.29 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.29 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.19 % |
| Unclassified | root | N/A | 25.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100865158 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105864527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2805 | Open in IMG/M |
| 3300000955|JGI1027J12803_101400003 | Not Available | 800 | Open in IMG/M |
| 3300000955|JGI1027J12803_102453196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100797977 | Not Available | 824 | Open in IMG/M |
| 3300003659|JGI25404J52841_10072729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300005167|Ga0066672_10228911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1192 | Open in IMG/M |
| 3300005293|Ga0065715_10755766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300005332|Ga0066388_100205938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2590 | Open in IMG/M |
| 3300005332|Ga0066388_101254794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300005332|Ga0066388_103300538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300005332|Ga0066388_103863228 | Not Available | 764 | Open in IMG/M |
| 3300005332|Ga0066388_106198882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300005347|Ga0070668_100718954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
| 3300005353|Ga0070669_100819342 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005435|Ga0070714_100066374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 3109 | Open in IMG/M |
| 3300005435|Ga0070714_100696750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300005436|Ga0070713_101603126 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005511|Ga0077121_10381434 | Not Available | 995 | Open in IMG/M |
| 3300005529|Ga0070741_10079122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3630 | Open in IMG/M |
| 3300005529|Ga0070741_10645183 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005537|Ga0070730_10046120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3177 | Open in IMG/M |
| 3300005537|Ga0070730_10054571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2871 | Open in IMG/M |
| 3300005538|Ga0070731_10066573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2391 | Open in IMG/M |
| 3300005538|Ga0070731_10744302 | Not Available | 651 | Open in IMG/M |
| 3300005543|Ga0070672_100164498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1842 | Open in IMG/M |
| 3300005543|Ga0070672_100516221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
| 3300005554|Ga0066661_10034990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2799 | Open in IMG/M |
| 3300005554|Ga0066661_10193080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae | 1259 | Open in IMG/M |
| 3300005560|Ga0066670_10338992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 916 | Open in IMG/M |
| 3300005561|Ga0066699_10810666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005562|Ga0058697_10376254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300005569|Ga0066705_10072232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1994 | Open in IMG/M |
| 3300005569|Ga0066705_10094337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1769 | Open in IMG/M |
| 3300005587|Ga0066654_10850866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005598|Ga0066706_11497324 | Not Available | 508 | Open in IMG/M |
| 3300005614|Ga0068856_101610638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300005617|Ga0068859_101365765 | Not Available | 781 | Open in IMG/M |
| 3300005617|Ga0068859_101681629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300005713|Ga0066905_100745110 | Not Available | 845 | Open in IMG/M |
| 3300005713|Ga0066905_101047262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300005713|Ga0066905_101381381 | Not Available | 637 | Open in IMG/M |
| 3300005764|Ga0066903_100141684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3422 | Open in IMG/M |
| 3300005764|Ga0066903_100205826 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
| 3300005764|Ga0066903_100341184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2412 | Open in IMG/M |
| 3300005764|Ga0066903_100410323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2235 | Open in IMG/M |
| 3300005764|Ga0066903_100702193 | Not Available | 1783 | Open in IMG/M |
| 3300005764|Ga0066903_100740488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 1743 | Open in IMG/M |
| 3300005764|Ga0066903_101066530 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005764|Ga0066903_101155265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1433 | Open in IMG/M |
| 3300005764|Ga0066903_101412467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1308 | Open in IMG/M |
| 3300005764|Ga0066903_101446814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
| 3300005764|Ga0066903_101891281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1143 | Open in IMG/M |
| 3300005764|Ga0066903_101963822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1123 | Open in IMG/M |
| 3300005764|Ga0066903_102630344 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005764|Ga0066903_103151355 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005764|Ga0066903_103922119 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005764|Ga0066903_104088257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300005764|Ga0066903_104582607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 737 | Open in IMG/M |
| 3300005764|Ga0066903_105079050 | Not Available | 697 | Open in IMG/M |
| 3300005764|Ga0066903_105462464 | Not Available | 670 | Open in IMG/M |
| 3300005764|Ga0066903_105534303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 666 | Open in IMG/M |
| 3300005764|Ga0066903_106509272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis | 609 | Open in IMG/M |
| 3300005764|Ga0066903_107141979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 578 | Open in IMG/M |
| 3300005764|Ga0066903_108419928 | Not Available | 526 | Open in IMG/M |
| 3300005921|Ga0070766_10489950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 815 | Open in IMG/M |
| 3300005921|Ga0070766_10641246 | Not Available | 716 | Open in IMG/M |
| 3300005921|Ga0070766_10675967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300005983|Ga0081540_1000183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 65356 | Open in IMG/M |
| 3300005983|Ga0081540_1325382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300005985|Ga0081539_10013948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 5997 | Open in IMG/M |
| 3300006028|Ga0070717_10038681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3878 | Open in IMG/M |
| 3300006028|Ga0070717_10236476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1610 | Open in IMG/M |
| 3300006028|Ga0070717_10705525 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006028|Ga0070717_10867336 | Not Available | 822 | Open in IMG/M |
| 3300006028|Ga0070717_11014378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300006028|Ga0070717_11152608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300006028|Ga0070717_11297931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300006032|Ga0066696_10894863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 565 | Open in IMG/M |
| 3300006038|Ga0075365_10826087 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006052|Ga0075029_100184340 | Not Available | 1297 | Open in IMG/M |
| 3300006057|Ga0075026_100081798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1576 | Open in IMG/M |
| 3300006057|Ga0075026_101062144 | Not Available | 507 | Open in IMG/M |
| 3300006059|Ga0075017_101374381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 555 | Open in IMG/M |
| 3300006163|Ga0070715_10004479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4589 | Open in IMG/M |
| 3300006163|Ga0070715_10147655 | Not Available | 1149 | Open in IMG/M |
| 3300006163|Ga0070715_10215783 | Not Available | 983 | Open in IMG/M |
| 3300006172|Ga0075018_10436996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300006173|Ga0070716_100968836 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 671 | Open in IMG/M |
| 3300006173|Ga0070716_101438367 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006175|Ga0070712_100522093 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006175|Ga0070712_101076831 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006175|Ga0070712_101448801 | Not Available | 600 | Open in IMG/M |
| 3300006175|Ga0070712_101472544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300006176|Ga0070765_100462175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1190 | Open in IMG/M |
| 3300006176|Ga0070765_100532865 | Not Available | 1105 | Open in IMG/M |
| 3300006176|Ga0070765_101396399 | Not Available | 660 | Open in IMG/M |
| 3300006176|Ga0070765_101963283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300006794|Ga0066658_10572111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 614 | Open in IMG/M |
| 3300006796|Ga0066665_11417262 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006797|Ga0066659_11841132 | Not Available | 513 | Open in IMG/M |
| 3300006806|Ga0079220_11211857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300006854|Ga0075425_100512573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300006854|Ga0075425_100799615 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300006854|Ga0075425_100804840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300006871|Ga0075434_101382823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 714 | Open in IMG/M |
| 3300006871|Ga0075434_101474151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300006893|Ga0073928_10416084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300006903|Ga0075426_11515918 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006904|Ga0075424_102313652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300006914|Ga0075436_100077857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2297 | Open in IMG/M |
| 3300006914|Ga0075436_100795816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300006953|Ga0074063_13547546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300007004|Ga0079218_11506384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300009143|Ga0099792_11000656 | Not Available | 558 | Open in IMG/M |
| 3300009174|Ga0105241_10979205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300009235|Ga0103857_10083657 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009553|Ga0105249_11001568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
| 3300009799|Ga0105075_1036321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300010040|Ga0126308_10089545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10 | 1867 | Open in IMG/M |
| 3300010043|Ga0126380_11561351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300010043|Ga0126380_12232898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300010046|Ga0126384_11299640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300010046|Ga0126384_11571810 | Not Available | 618 | Open in IMG/M |
| 3300010052|Ga0133944_1001835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 39768 | Open in IMG/M |
| 3300010326|Ga0134065_10351894 | Not Available | 579 | Open in IMG/M |
| 3300010358|Ga0126370_12316170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300010360|Ga0126372_11022983 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300010360|Ga0126372_11866735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300010360|Ga0126372_12506594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300010360|Ga0126372_12626927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300010361|Ga0126378_10561191 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300010362|Ga0126377_13401120 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010362|Ga0126377_13496908 | Not Available | 508 | Open in IMG/M |
| 3300010366|Ga0126379_12347238 | Not Available | 633 | Open in IMG/M |
| 3300010366|Ga0126379_12513276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300010376|Ga0126381_100049411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5142 | Open in IMG/M |
| 3300010376|Ga0126381_100789221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300010376|Ga0126381_102185230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 796 | Open in IMG/M |
| 3300010376|Ga0126381_102737551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 704 | Open in IMG/M |
| 3300010398|Ga0126383_10279256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1656 | Open in IMG/M |
| 3300010398|Ga0126383_11673502 | Not Available | 725 | Open in IMG/M |
| 3300010398|Ga0126383_13560019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5 | 509 | Open in IMG/M |
| 3300010398|Ga0126383_13597673 | Not Available | 506 | Open in IMG/M |
| 3300010399|Ga0134127_13234872 | Not Available | 532 | Open in IMG/M |
| 3300010400|Ga0134122_10341037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1301 | Open in IMG/M |
| 3300010860|Ga0126351_1093772 | Not Available | 709 | Open in IMG/M |
| 3300011271|Ga0137393_10438673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1119 | Open in IMG/M |
| 3300011413|Ga0137333_1067446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
| 3300011445|Ga0137427_10186071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 861 | Open in IMG/M |
| 3300012149|Ga0153941_1024039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1187 | Open in IMG/M |
| 3300012168|Ga0137357_1031929 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300012169|Ga0153990_1148844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 522 | Open in IMG/M |
| 3300012181|Ga0153922_1038222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300012199|Ga0137383_10050883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2961 | Open in IMG/M |
| 3300012677|Ga0153928_1000131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 39286 | Open in IMG/M |
| 3300012685|Ga0137397_11273319 | Not Available | 525 | Open in IMG/M |
| 3300012912|Ga0157306_10071418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 934 | Open in IMG/M |
| 3300012917|Ga0137395_10306278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300012930|Ga0137407_10877182 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012971|Ga0126369_10169139 | Not Available | 2076 | Open in IMG/M |
| 3300012971|Ga0126369_10322476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1555 | Open in IMG/M |
| 3300012971|Ga0126369_10597983 | Not Available | 1173 | Open in IMG/M |
| 3300012971|Ga0126369_13580621 | Not Available | 509 | Open in IMG/M |
| 3300013297|Ga0157378_11790161 | Not Available | 662 | Open in IMG/M |
| 3300013306|Ga0163162_13299304 | Not Available | 517 | Open in IMG/M |
| 3300014199|Ga0181535_10118266 | Not Available | 1689 | Open in IMG/M |
| 3300014325|Ga0163163_11216475 | Not Available | 816 | Open in IMG/M |
| 3300014326|Ga0157380_10745776 | Not Available | 990 | Open in IMG/M |
| 3300014326|Ga0157380_12512150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300014654|Ga0181525_10159444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1236 | Open in IMG/M |
| 3300015245|Ga0137409_10037951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4639 | Open in IMG/M |
| 3300015264|Ga0137403_10284329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1554 | Open in IMG/M |
| 3300015371|Ga0132258_12704997 | Not Available | 1238 | Open in IMG/M |
| 3300015374|Ga0132255_104288072 | Not Available | 605 | Open in IMG/M |
| 3300016294|Ga0182041_11178990 | Not Available | 698 | Open in IMG/M |
| 3300016319|Ga0182033_10217845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1530 | Open in IMG/M |
| 3300016319|Ga0182033_11377548 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300016404|Ga0182037_10937683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 752 | Open in IMG/M |
| 3300017822|Ga0187802_10000138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16449 | Open in IMG/M |
| 3300017928|Ga0187806_1047310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1304 | Open in IMG/M |
| 3300017970|Ga0187783_10010021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6965 | Open in IMG/M |
| 3300017972|Ga0187781_10131488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1750 | Open in IMG/M |
| 3300017972|Ga0187781_10302303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1135 | Open in IMG/M |
| 3300017972|Ga0187781_10465735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 906 | Open in IMG/M |
| 3300017972|Ga0187781_10656425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300017975|Ga0187782_10368757 | Not Available | 1088 | Open in IMG/M |
| 3300017975|Ga0187782_10437998 | Not Available | 996 | Open in IMG/M |
| 3300017975|Ga0187782_10537076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300017975|Ga0187782_10612143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300017975|Ga0187782_11241375 | Not Available | 584 | Open in IMG/M |
| 3300017994|Ga0187822_10354399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 531 | Open in IMG/M |
| 3300018028|Ga0184608_10479795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300018058|Ga0187766_10341805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
| 3300018062|Ga0187784_10005157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10576 | Open in IMG/M |
| 3300018064|Ga0187773_10771861 | Not Available | 608 | Open in IMG/M |
| 3300018066|Ga0184617_1165587 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018085|Ga0187772_10508800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300018422|Ga0190265_10985153 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300018468|Ga0066662_10347898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
| 3300018482|Ga0066669_10842586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300020579|Ga0210407_11317869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 539 | Open in IMG/M |
| 3300020583|Ga0210401_10124452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2418 | Open in IMG/M |
| 3300020583|Ga0210401_10458818 | Not Available | 1137 | Open in IMG/M |
| 3300020583|Ga0210401_10947016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300020583|Ga0210401_11262576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300021088|Ga0210404_10129854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1303 | Open in IMG/M |
| 3300021088|Ga0210404_10470977 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300021088|Ga0210404_10587039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300021088|Ga0210404_10771314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300021170|Ga0210400_10736492 | Not Available | 810 | Open in IMG/M |
| 3300021170|Ga0210400_10795038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 776 | Open in IMG/M |
| 3300021178|Ga0210408_10001493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 24410 | Open in IMG/M |
| 3300021178|Ga0210408_10002061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 20080 | Open in IMG/M |
| 3300021178|Ga0210408_10003067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15618 | Open in IMG/M |
| 3300021362|Ga0213882_10131584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300021374|Ga0213881_10046827 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300021374|Ga0213881_10094358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1291 | Open in IMG/M |
| 3300021374|Ga0213881_10105791 | Not Available | 1219 | Open in IMG/M |
| 3300021374|Ga0213881_10124120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1124 | Open in IMG/M |
| 3300021384|Ga0213876_10046722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2289 | Open in IMG/M |
| 3300021384|Ga0213876_10175794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300021384|Ga0213876_10187594 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300021388|Ga0213875_10390313 | Not Available | 663 | Open in IMG/M |
| 3300021388|Ga0213875_10588503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 537 | Open in IMG/M |
| 3300021407|Ga0210383_11390435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 584 | Open in IMG/M |
| 3300021432|Ga0210384_10178347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1909 | Open in IMG/M |
| 3300021432|Ga0210384_10202562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1784 | Open in IMG/M |
| 3300021439|Ga0213879_10170354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300021476|Ga0187846_10048621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1881 | Open in IMG/M |
| 3300021476|Ga0187846_10276633 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 696 | Open in IMG/M |
| 3300021476|Ga0187846_10381184 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300021478|Ga0210402_11395601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300021559|Ga0210409_10008185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 10676 | Open in IMG/M |
| 3300021560|Ga0126371_10025926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5450 | Open in IMG/M |
| 3300025297|Ga0209758_1104827 | Not Available | 795 | Open in IMG/M |
| 3300025474|Ga0208479_1089993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300025901|Ga0207688_10191783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1222 | Open in IMG/M |
| 3300025904|Ga0207647_10405194 | Not Available | 768 | Open in IMG/M |
| 3300025904|Ga0207647_10803021 | Not Available | 506 | Open in IMG/M |
| 3300025906|Ga0207699_10506859 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300025906|Ga0207699_10863498 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300025908|Ga0207643_10204423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1204 | Open in IMG/M |
| 3300025914|Ga0207671_10345337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 1180 | Open in IMG/M |
| 3300025928|Ga0207700_10459688 | Not Available | 1123 | Open in IMG/M |
| 3300025929|Ga0207664_10406573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1211 | Open in IMG/M |
| 3300025929|Ga0207664_10568537 | Not Available | 1018 | Open in IMG/M |
| 3300025933|Ga0207706_11523562 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025936|Ga0207670_11396950 | Not Available | 594 | Open in IMG/M |
| 3300025938|Ga0207704_11652226 | Not Available | 550 | Open in IMG/M |
| 3300025986|Ga0207658_10956462 | Not Available | 781 | Open in IMG/M |
| 3300026088|Ga0207641_11577505 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026309|Ga0209055_1111495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae | 1064 | Open in IMG/M |
| 3300026530|Ga0209807_1054676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1828 | Open in IMG/M |
| 3300026550|Ga0209474_10461317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300026552|Ga0209577_10035697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4294 | Open in IMG/M |
| 3300026552|Ga0209577_10138614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1927 | Open in IMG/M |
| 3300026552|Ga0209577_10176630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1659 | Open in IMG/M |
| 3300026552|Ga0209577_10411908 | Not Available | 967 | Open in IMG/M |
| 3300026552|Ga0209577_10431706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 930 | Open in IMG/M |
| 3300026863|Ga0209902_103672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3159 | Open in IMG/M |
| 3300026988|Ga0207834_1025796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300027857|Ga0209166_10271865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300027869|Ga0209579_10404010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 740 | Open in IMG/M |
| 3300027874|Ga0209465_10116047 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300027874|Ga0209465_10496134 | Not Available | 610 | Open in IMG/M |
| 3300027889|Ga0209380_10123471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1507 | Open in IMG/M |
| 3300027898|Ga0209067_10932309 | Not Available | 511 | Open in IMG/M |
| 3300028720|Ga0307317_10157263 | Not Available | 764 | Open in IMG/M |
| 3300028824|Ga0307310_10645670 | Not Available | 541 | Open in IMG/M |
| 3300028906|Ga0308309_10629618 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300028906|Ga0308309_11136370 | Not Available | 675 | Open in IMG/M |
| 3300028906|Ga0308309_11648426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300029636|Ga0222749_10166291 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031057|Ga0170834_104548438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1237 | Open in IMG/M |
| 3300031128|Ga0170823_15951238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1432 | Open in IMG/M |
| 3300031226|Ga0307497_10170933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300031446|Ga0170820_11242908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300031446|Ga0170820_15065383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2361 | Open in IMG/M |
| 3300031543|Ga0318516_10780041 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031544|Ga0318534_10538718 | Not Available | 665 | Open in IMG/M |
| 3300031545|Ga0318541_10039669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2377 | Open in IMG/M |
| 3300031547|Ga0310887_10780036 | Not Available | 599 | Open in IMG/M |
| 3300031564|Ga0318573_10734023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300031682|Ga0318560_10084349 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300031711|Ga0265314_10005299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11670 | Open in IMG/M |
| 3300031715|Ga0307476_10676740 | Not Available | 764 | Open in IMG/M |
| 3300031715|Ga0307476_10764869 | Not Available | 715 | Open in IMG/M |
| 3300031718|Ga0307474_11078360 | Not Available | 636 | Open in IMG/M |
| 3300031720|Ga0307469_11234681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708 | Open in IMG/M |
| 3300031720|Ga0307469_11919128 | Not Available | 574 | Open in IMG/M |
| 3300031730|Ga0307516_10761931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 628 | Open in IMG/M |
| 3300031744|Ga0306918_11338355 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031753|Ga0307477_10390864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis | 953 | Open in IMG/M |
| 3300031753|Ga0307477_10799874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300031765|Ga0318554_10585779 | Not Available | 629 | Open in IMG/M |
| 3300031768|Ga0318509_10452311 | Not Available | 718 | Open in IMG/M |
| 3300031768|Ga0318509_10491478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300031782|Ga0318552_10526354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300031797|Ga0318550_10129320 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300031820|Ga0307473_11448076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300031823|Ga0307478_10465632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300031823|Ga0307478_10595769 | Not Available | 924 | Open in IMG/M |
| 3300031823|Ga0307478_11547669 | Not Available | 548 | Open in IMG/M |
| 3300031845|Ga0318511_10439477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300031854|Ga0310904_10634318 | Not Available | 733 | Open in IMG/M |
| 3300031858|Ga0310892_11290434 | Not Available | 522 | Open in IMG/M |
| 3300031879|Ga0306919_11206137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300031890|Ga0306925_11948966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300031912|Ga0306921_10831275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300031912|Ga0306921_11751775 | Not Available | 670 | Open in IMG/M |
| 3300031941|Ga0310912_11203529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300031954|Ga0306926_11360957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
| 3300031959|Ga0318530_10215219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300032039|Ga0318559_10460897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 593 | Open in IMG/M |
| 3300032059|Ga0318533_10790554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 696 | Open in IMG/M |
| 3300032059|Ga0318533_10801756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300032068|Ga0318553_10631302 | Not Available | 561 | Open in IMG/M |
| 3300032076|Ga0306924_12239925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300032174|Ga0307470_10112709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300032174|Ga0307470_11853545 | Not Available | 512 | Open in IMG/M |
| 3300032205|Ga0307472_100479727 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300032205|Ga0307472_101246647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300032205|Ga0307472_102025890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300032261|Ga0306920_102138839 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300032892|Ga0335081_10000845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 49278 | Open in IMG/M |
| 3300032892|Ga0335081_10701264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1228 | Open in IMG/M |
| 3300032954|Ga0335083_11406695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense | 533 | Open in IMG/M |
| 3300033004|Ga0335084_11434861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300033158|Ga0335077_10768210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300033158|Ga0335077_10876279 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300033158|Ga0335077_11152356 | Not Available | 762 | Open in IMG/M |
| 3300033289|Ga0310914_10045808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3584 | Open in IMG/M |
| 3300033550|Ga0247829_10508301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300034155|Ga0370498_066558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300034155|Ga0370498_134200 | Not Available | 591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.35% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.47% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.17% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.17% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.59% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.29% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.29% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.29% |
| Liquid | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.29% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.29% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.29% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.29% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.29% |
| Cyanobacterial | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.29% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.29% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.29% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010052 | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012149 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaG | Host-Associated | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026863 | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1008651582 | 3300000364 | Soil | MILSDLPTPPEATFHAMGPWKGFAQAGNRCPLFGIM |
| INPhiseqgaiiFebDRAFT_1058645271 | 3300000364 | Soil | MILSDLPTPASVHATGSCKGFAQAGNRYALLRIMRQ |
| JGI1027J12803_1014000031 | 3300000955 | Soil | CLRMILSDLPTPAEASVRAVRPRKGFAQAGTRYTLFGIMR* |
| JGI1027J12803_1024531961 | 3300000955 | Soil | MILSDLPTPAEASVHAIGSRKGFAQAGNRFTSRIKS |
| JGIcombinedJ26739_1007979771 | 3300002245 | Forest Soil | IFSDLPSPAEASSQMTNRATGFAQAGNRCPLFGIML* |
| JGI25404J52841_100727291 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LSDLPLPAEASSQTESPAKGFAQAGNRSPFFGIMLYQRTR* |
| Ga0066672_102289112 | 3300005167 | Soil | MSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML* |
| Ga0065715_107557662 | 3300005293 | Miscanthus Rhizosphere | LSLCLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR* |
| Ga0066388_1002059383 | 3300005332 | Tropical Forest Soil | VHAFSESMIFSDLASPAEASGHATKRTKGFAQAGNRYPLFGIML* |
| Ga0066388_1012547942 | 3300005332 | Tropical Forest Soil | MILSDLASFAEASNETANGWRGFAQAGNRYPLFGIILQAVRA* |
| Ga0066388_1033005382 | 3300005332 | Tropical Forest Soil | YLSMIFSDLASPAEALTEGTSRWQGFAQAGNRFPLFRIML* |
| Ga0066388_1038632282 | 3300005332 | Tropical Forest Soil | WWSMIFSDLPSPAEASVLTAGACKGSAQAGNRFTLFGIML* |
| Ga0066388_1061988822 | 3300005332 | Tropical Forest Soil | MIFSGLASPAEASNRNNGPIMGFAKAGNRYPLFGIMLWARDKGWR |
| Ga0070668_1007189541 | 3300005347 | Switchgrass Rhizosphere | WSMIFSDLPSPAEASIHAGGPRHGFAQAGNRYPLFGIMLEGY* |
| Ga0070669_1008193422 | 3300005353 | Switchgrass Rhizosphere | MRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIMRYRGASAS |
| Ga0070714_1000663744 | 3300005435 | Agricultural Soil | MIFSDLASPAEASNQVTKRCKGFAQAGNRYPLFGIMRYAANGCLT* |
| Ga0070714_1006967503 | 3300005435 | Agricultural Soil | MISRVFWSMMFSDLPSPAEALSHTTSNAAGFAQAGNRYPLFGIML* |
| Ga0070713_1016031262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP* |
| Ga0077121_103814342 | 3300005511 | Arabidopsis Rhizosphere | MIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS* |
| Ga0070741_100791225 | 3300005529 | Surface Soil | VILSDLPSPAEASILHEVRRDGFAQAGNRCERFGITRETTSQAS* |
| Ga0070741_106451832 | 3300005529 | Surface Soil | MIFSDLPSPAEASIRWEDRCDGFAQAGNRHPLFGIML* |
| Ga0070730_100461204 | 3300005537 | Surface Soil | MIFSDLPSPAEASSRTNNASQGFAQAENRFPLFRIML* |
| Ga0070730_100545715 | 3300005537 | Surface Soil | MIFSDLPSPAEASGRMEGLCTGFAQAGNRCTLFRIML* |
| Ga0070731_100665734 | 3300005538 | Surface Soil | MIFSDLPSPAEASSQIDEQCQGFAQAGNRRPLFGIML* |
| Ga0070731_107443022 | 3300005538 | Surface Soil | MILSDLPWPAEASSQTDAPCQGFAQAGNRRPLFGIMLYGFK |
| Ga0070672_1001644982 | 3300005543 | Miscanthus Rhizosphere | MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR* |
| Ga0070672_1005162211 | 3300005543 | Miscanthus Rhizosphere | MIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR* |
| Ga0066661_100349902 | 3300005554 | Soil | MIFSDLPSPAEASSQTTDRGRGFAQAGNRYPLFGIML* |
| Ga0066661_101930802 | 3300005554 | Soil | MIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML* |
| Ga0066670_103389922 | 3300005560 | Soil | MIFSDLPSPAEALSESATRCHGFAQAGNRFPLFGIML* |
| Ga0066699_108106662 | 3300005561 | Soil | CLSMIFPDLPSPAEATNERTGVSQGFAQAGNRHPLFGIMR* |
| Ga0058697_103762542 | 3300005562 | Agave | MIFSDLPTPAEASVDSQTVQGFAQAGNRYPLFGIML* |
| Ga0066705_100722322 | 3300005569 | Soil | MIFSDLASPAEARVATRDRYEGFAQAGNRYSLFGIML* |
| Ga0066705_100943372 | 3300005569 | Soil | MIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML* |
| Ga0066654_108508662 | 3300005587 | Soil | YCLSMIFSDLPSPAEASNETANRCLGFAQAGNRFPLFGIML* |
| Ga0066706_114973241 | 3300005598 | Soil | MILSDLPSPAEASNETTNRCLGFAQAGNRFPLFGIM |
| Ga0068856_1016106383 | 3300005614 | Corn Rhizosphere | MIFPDLPSPAEAAIHEFGRCRGFAQAGNRFPLFGIML* |
| Ga0068859_1013657652 | 3300005617 | Switchgrass Rhizosphere | MIFSDQPSPAEASIHNRRRCQGFAQAGNCFTLFGIMRPSPERA* |
| Ga0068859_1016816292 | 3300005617 | Switchgrass Rhizosphere | MIFSDLPTPAEASVLSTRMCRGFAQAGNRDTLFGIMLAGS* |
| Ga0066905_1007451101 | 3300005713 | Tropical Forest Soil | MIFSDLPSPAEALSHTTGLCKGFAQAGNRYPLLARA |
| Ga0066905_1010472622 | 3300005713 | Tropical Forest Soil | MIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTML* |
| Ga0066905_1013813812 | 3300005713 | Tropical Forest Soil | MIFSDLPSPAEASSHRAGCANGFAQAGNRYPLFGIMLYARSACRTERKN* |
| Ga0066903_1001416842 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL* |
| Ga0066903_1002058262 | 3300005764 | Tropical Forest Soil | MMFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML* |
| Ga0066903_1003411844 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML* |
| Ga0066903_1004103232 | 3300005764 | Tropical Forest Soil | MDSSFIVWSMIFSDLPSPAEASSKTTNRARGFAQAGNRYPLFGIML* |
| Ga0066903_1007021932 | 3300005764 | Tropical Forest Soil | MMFSDLPSPAEASSQTTDGAKGFAQAGNRYPLFGIML* |
| Ga0066903_1007404882 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEALSQSMTDATGFAQAGNRFPLFGIMR* |
| Ga0066903_1010665303 | 3300005764 | Tropical Forest Soil | MIFSDLPSLAEASSQTTKRATGFAQAGNRYPLFGIML* |
| Ga0066903_1011552652 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEAPSRTMNLATGFAQAGNRYPLFGIML* |
| Ga0066903_1014124672 | 3300005764 | Tropical Forest Soil | MIFTDLPSPAEASSRTTDGAKGFAQAGNRYPLFGIM |
| Ga0066903_1014468143 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASCEQISGWQSFAQAENPSPLFRIML* |
| Ga0066903_1018912812 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASFYALEACQGFAQAGNRFPLFGIMHR* |
| Ga0066903_1019638222 | 3300005764 | Tropical Forest Soil | MSFSDLPSPAEAFFDAAGVCQGFAQAGNRCTLFGIML* |
| Ga0066903_1023735623 | 3300005764 | Tropical Forest Soil | MIFSDLASPAEASCKTMNRTKGYAQAGNRYPLFGIMLQGHFAAFASL* |
| Ga0066903_1026303442 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSQTTIGATGFAQAGNRYPLFGIML* |
| Ga0066903_1031513554 | 3300005764 | Tropical Forest Soil | MIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML* |
| Ga0066903_1039221192 | 3300005764 | Tropical Forest Soil | MIFSDLASPAEATSHMKFGGQGFAQAGNRYPLFGIMR* |
| Ga0066903_1040882572 | 3300005764 | Tropical Forest Soil | MIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTMR* |
| Ga0066903_1045826072 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSQTTNGAKGFAQAGNRYPLFGIML* |
| Ga0066903_1050790502 | 3300005764 | Tropical Forest Soil | MILSDLASPAEASSRTTDSAKGFAQAGNRYPLFAIML* |
| Ga0066903_1054624641 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASAHTPRACKGFAQAGNRYPLFGIVL |
| Ga0066903_1055343032 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML* |
| Ga0066903_1065092722 | 3300005764 | Tropical Forest Soil | SDLPSPAEASFHTAGVCGGFAQAGNRFTLFGIMLEERMR* |
| Ga0066903_1071419792 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIML* |
| Ga0066903_1084199282 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASNQAMDCAKGFAQAGNRYPLFGIMR |
| Ga0070766_104899502 | 3300005921 | Soil | SMILSDLPSPAEAGFAQAGNRYPLFGTMRCCPYPLTAPVSPAT* |
| Ga0070766_106412462 | 3300005921 | Soil | MIFSDLPSPAEAPGQMTSPYQGFAQAGNRYPLFGIM |
| Ga0070766_106759672 | 3300005921 | Soil | SFPDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML* |
| Ga0081540_100018358 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MIFSDLPSPAEATSRTAEAHQGFAQAGNRHPLFGIVL* |
| Ga0081540_13253822 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MIFSDLPWPAEACFDAAGARQGFAQAGDRVSLFGIMR* |
| Ga0081539_100139486 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MIFSDLPAPAEALVDRVRPCQGFAQAGNRFPLFEIML* |
| Ga0070717_100386813 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSQTANCAKGFAQAGNRYPLFGIML* |
| Ga0070717_102364761 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLASPAEARRHTMNRAKGFAQAGNRFPLFGIML* |
| Ga0070717_107055252 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSRMDGSLEGFAQAGNRYPLFGIMLA* |
| Ga0070717_108673361 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TSSWSMIFSDLPSPAEASSETAKRATGFAQAGNRFPLFGVMLE* |
| Ga0070717_110143782 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASNNTKNRCQGFAQAGNRFPLFGIVL* |
| Ga0070717_111526082 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLASPAEASSQTNFGGQGFAQAGNRFPLFGIML* |
| Ga0070717_112979313 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLASPAEASSHTKLGGQGFAQAGNRFPLFGIML* |
| Ga0066696_108948632 | 3300006032 | Soil | MIFSDQPSPAEASNETTNRWLGFAQAGNRFPLFGIML* |
| Ga0075365_108260872 | 3300006038 | Populus Endosphere | LSVIFSDLPSPAEALIHTRGLSKGFAQAGNRFPLFGIML |
| Ga0075029_1001843401 | 3300006052 | Watersheds | MIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML* |
| Ga0075026_1000817982 | 3300006057 | Watersheds | MILSDLPSPAEAVSEIAMFAKGFAQAGNRFPLFGIMR* |
| Ga0075026_1010621442 | 3300006057 | Watersheds | MIFSDPASPAEAGHESNSGQSFAQAGNRHPLFGIML |
| Ga0075017_1013743812 | 3300006059 | Watersheds | MIFSDLASPAEALYETISRLHGFAQAGNRRPLFGIML* |
| Ga0070715_100044793 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MFSDLASPAEAPSHTMKRSKGFAQAGNRYPLFGIMLYCSGP* |
| Ga0070715_101476552 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIMR* |
| Ga0070715_102157832 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAVYFWSMIFSDLPSPAEASSHTTSRATGFAQAGNRYPLFGIMR* |
| Ga0075018_104369962 | 3300006172 | Watersheds | MIFSDLPSPAEASNGKTKVWQGFAQAGNRFPLFRILL* |
| Ga0070716_1009688362 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPLFGIMLR* |
| Ga0070716_1014383672 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML* |
| Ga0070712_1005220932 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLASPAEASSPNDGPIMGFAKAGNRYPLFGIML* |
| Ga0070712_1010768311 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IFSDLASPAEASSPTTFDGQGFAQAGNRLLLFGIML* |
| Ga0070712_1014488011 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SMMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIML* |
| Ga0070712_1014725442 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLASPAEAWNGDTSSWHGFAQAGNRYPLFGIML* |
| Ga0070765_1004621752 | 3300006176 | Soil | MMFPDLPSPAEALCQTTNGTMGFAQAGNRYPLFGIML* |
| Ga0070765_1005328651 | 3300006176 | Soil | MIFSDLPSPAEAPSQMTSRNQGFAQAGNRYPLFGIML |
| Ga0070765_1013963992 | 3300006176 | Soil | MIFSDLPSPAEASNNTTNRCHGFAQAGNRFPLFGIMP* |
| Ga0070765_1019632831 | 3300006176 | Soil | MILPDLPSPAEASGQSHRLRQGFAQAGTRHPLFGIML* |
| Ga0066658_105721112 | 3300006794 | Soil | MILSDLPTPAEVFVHEKRLRQGFAQAGNRCPLFGIMR* |
| Ga0066665_114172622 | 3300006796 | Soil | FSDLPSPAEASNETTNRCLGFAQAENRFPLFGIMP* |
| Ga0066659_118411321 | 3300006797 | Soil | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR* |
| Ga0079220_112118572 | 3300006806 | Agricultural Soil | MIFPDLPSPAEASKKDKQLLGFAQAGNRYPLSGIML* |
| Ga0075425_1005125732 | 3300006854 | Populus Rhizosphere | MIFSDLPSPAEASSQTMIGATGFAQAGNRFPLFGIML* |
| Ga0075425_1007996152 | 3300006854 | Populus Rhizosphere | MIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML* |
| Ga0075425_1008048403 | 3300006854 | Populus Rhizosphere | MIFSDLPSPAEASSQTTTGTTGFAQAGNRYPLFGIML* |
| Ga0075434_1013828231 | 3300006871 | Populus Rhizosphere | PFCWSMIFSDLPSPAEASSQTTNRNKGFAQAGNRSPLFGIML* |
| Ga0075434_1014741512 | 3300006871 | Populus Rhizosphere | MIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML* |
| Ga0073928_104160842 | 3300006893 | Iron-Sulfur Acid Spring | MIFSDLPSPAEASNEPTRSWLSFAQAGNRYPLFGIML* |
| Ga0075426_115159182 | 3300006903 | Populus Rhizosphere | CLSMIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP* |
| Ga0075424_1023136521 | 3300006904 | Populus Rhizosphere | MIFSDLPSPAEAPSPSSRYRLGFAQAGNRYPLFGIML |
| Ga0075436_1000778572 | 3300006914 | Populus Rhizosphere | MICSDLPSPAEASSQMTEPSQGFAQAGNRYPLFGIML* |
| Ga0075436_1007958162 | 3300006914 | Populus Rhizosphere | MIFSDLASPAEASSHTTFSGQGFAQAGNRYPLFGIML* |
| Ga0074063_135475463 | 3300006953 | Soil | SMILSDLPTPAEASVHKSGPYLGFAQAGNRFPLFGIMR* |
| Ga0079218_115063842 | 3300007004 | Agricultural Soil | MILSDLPSPAEASSKKGEPCQGFAQAGNRFPLFGIML |
| Ga0099792_110006562 | 3300009143 | Vadose Zone Soil | MIFSDLPSPAEAPSHSSRYRLGFAQAGNRYPLFGIML* |
| Ga0105241_109792052 | 3300009174 | Corn Rhizosphere | AAHDFSFWSMIFSDLPSPAEAGFAKAGNRFPLFGIMLTPPR* |
| Ga0103857_100836572 | 3300009235 | River Water | MIFSDLPSPAEASGNTTRTYQGFAQAGNRFPLFGIML* |
| Ga0105249_110015682 | 3300009553 | Switchgrass Rhizosphere | CLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR* |
| Ga0105075_10363212 | 3300009799 | Groundwater Sand | SDLPSPAEASSQNDEPCQGFAQAGNRFPLFGIML* |
| Ga0126308_100895454 | 3300010040 | Serpentine Soil | AKSLCMIFSDPPSPAEAFVHKNGPCQGFAQAGNRCPLFGIML* |
| Ga0126380_115613511 | 3300010043 | Tropical Forest Soil | MISSDLPSPAEAPNHPTGFAKDFAQAGNRRPLFGIMLYCSSGLP |
| Ga0126380_122328981 | 3300010043 | Tropical Forest Soil | MISSDLPSPAEASSRKDDLNEGFAQAENRRTLFRIAR* |
| Ga0126384_112996402 | 3300010046 | Tropical Forest Soil | MILSDLPSPAEAAKRMPNQATGFVQAGNRYPLFGIML* |
| Ga0126384_115718101 | 3300010046 | Tropical Forest Soil | ISFSDLPSPAKASSHAKNLAKGFAQAGNRRPLFRDMR* |
| Ga0133944_100183537 | 3300010052 | Liquid | MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML* |
| Ga0134065_103518942 | 3300010326 | Grasslands Soil | LDSDWSMILSDLPSPAEASSLTAKNCKGFAQAGNRFPLFGNML* |
| Ga0126370_123161701 | 3300010358 | Tropical Forest Soil | LGYCWSMMSSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML* |
| Ga0126372_110229832 | 3300010360 | Tropical Forest Soil | MILYDLPSPAEASFQMEGACQGFAQAANRFPLFGIML* |
| Ga0126372_118667352 | 3300010360 | Tropical Forest Soil | MIFSDLASPAEASSQTTNRAKGFAQAGNRYPLFGIML* |
| Ga0126372_125065942 | 3300010360 | Tropical Forest Soil | MILSDLPSPAEASSKTSNRARGFAQAGNRFPLFGIMRW* |
| Ga0126372_126269272 | 3300010360 | Tropical Forest Soil | SSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML* |
| Ga0126378_105611911 | 3300010361 | Tropical Forest Soil | MIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML* |
| Ga0126377_134011202 | 3300010362 | Tropical Forest Soil | MIFSDLPSPAEALFDTAGPCRGFAQAGNRVTLFGIML* |
| Ga0126377_134969082 | 3300010362 | Tropical Forest Soil | LCLIFSNLPSRAEASIHVHERCEGFAQGGNRFPLFGIMH* |
| Ga0126379_123472382 | 3300010366 | Tropical Forest Soil | CWSMMFSDLPSPAEASSQTTTRATGFAQAGNRYPLFGLML* |
| Ga0126379_125132762 | 3300010366 | Tropical Forest Soil | MILSDLPSPAEASSHEMNYAKGFAQAGNRYPLFGIMH |
| Ga0126381_1000494118 | 3300010376 | Tropical Forest Soil | MIFSDLPSPAEASSRMKRWFEGFAQAGNRYPLFGIML* |
| Ga0126381_1007892212 | 3300010376 | Tropical Forest Soil | MIFPDLPSPAEASSGMPNQATGFAQAGNHYTLFGIML* |
| Ga0126381_1021852302 | 3300010376 | Tropical Forest Soil | MILFDLPSPAEAPTETANHSDGFAQAGNRFPLVGIMR* |
| Ga0126381_1027375512 | 3300010376 | Tropical Forest Soil | MIFSDLPSPAEALSENSTGLLGFAQVGNRFPLFRIML* |
| Ga0126383_102792562 | 3300010398 | Tropical Forest Soil | MIFSDLPSPAEASSNAHGFRQGFAQAGNRCTLSWIVR* |
| Ga0126383_116735021 | 3300010398 | Tropical Forest Soil | MIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIMLLLRT |
| Ga0126383_135600192 | 3300010398 | Tropical Forest Soil | MIFSDLASPAEALTEKRGRWQGFALAENRYPLFRIML* |
| Ga0126383_135976732 | 3300010398 | Tropical Forest Soil | MIFSDLSSPAEASSRVKRWLKGFAQAGNRYPLFGIML* |
| Ga0134127_132348722 | 3300010399 | Terrestrial Soil | MIFSDLPSPAEEGFAKAGNRYPLFGIMRLRRARERLL |
| Ga0134122_103410372 | 3300010400 | Terrestrial Soil | MIFSDLPTPAEASVNATGPRQGFAQAGNRFTLFGIMLYAPASQ* |
| Ga0126351_10937722 | 3300010860 | Boreal Forest Soil | SMIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML* |
| Ga0137393_104386732 | 3300011271 | Vadose Zone Soil | MIFSDLASPAEASDEVQMVAKSFAQAGNRFPLFRIML* |
| Ga0137333_10674461 | 3300011413 | Soil | MILCFAFYWGMTFSDLPSPAKASSQNGEPYQGFAQAGNRFPLFGV |
| Ga0137427_101860712 | 3300011445 | Soil | LSDLPSPAEAGFAKAGNRYPLFGIMRSNPFDDALAE |
| Ga0153941_10240392 | 3300012149 | Attine Ant Fungus Gardens | MFFSNPPSPAEAPSQTTIRAKGFAQAGNRYPLFGIML* |
| Ga0137357_10319292 | 3300012168 | Soil | MILSGLPSPAEAGFAKAGNRFPLFGIMLYDSGTTAICSLNAGRDE |
| Ga0153990_11488442 | 3300012169 | Attine Ant Fungus Gardens | MIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIMR* |
| Ga0153922_10382221 | 3300012181 | Attine Ant Fungus Gardens | IFSDLASPAEAAAGTTNGSQGFAQAGNRCPFLGIML* |
| Ga0137383_100508837 | 3300012199 | Vadose Zone Soil | MMFPDLPSPAEASSQMTNSAKGFAQAGNRYPLFGIML |
| Ga0153928_10001318 | 3300012677 | Attine Ant Fungus Gardens | MIFSDLPSPAEASSQTTIGDTGFAQAGNRYPLFGIML* |
| Ga0137397_112733192 | 3300012685 | Vadose Zone Soil | MIFFDLPTPAEASAHTIALRQGFAQAGNRHPLFGIMP* |
| Ga0157306_100714182 | 3300012912 | Soil | MILSDLPTPAEASFYTTGRRKGFAQAGNRCTLFGIMR* |
| Ga0137395_103062782 | 3300012917 | Vadose Zone Soil | MIFFDLPSPAEASAHTIALREGFAQAGNRHPLFGIMP* |
| Ga0137407_108771821 | 3300012930 | Vadose Zone Soil | MIFSDLPTPAEASVHTIELRQGFAQAGNRYPLFGIM |
| Ga0126369_101691393 | 3300012971 | Tropical Forest Soil | MIFSDLPSPAEAASHTTDRAKGFAQAGNRYPLFGIMLCALVA |
| Ga0126369_103224761 | 3300012971 | Tropical Forest Soil | LAYCWSMMFSDLPSPAEAPSQMTTGATGFAQAGNRCPLFGIML* |
| Ga0126369_105979832 | 3300012971 | Tropical Forest Soil | SMIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL* |
| Ga0126369_135806211 | 3300012971 | Tropical Forest Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLW |
| Ga0157378_117901612 | 3300013297 | Miscanthus Rhizosphere | SDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR* |
| Ga0163162_132993041 | 3300013306 | Switchgrass Rhizosphere | DLPTPAEASILSTRMCRGFAQAGNRDTLFGIMLAGS* |
| Ga0181535_101182662 | 3300014199 | Bog | FSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML* |
| Ga0163163_112164751 | 3300014325 | Switchgrass Rhizosphere | IFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR* |
| Ga0157380_107457762 | 3300014326 | Switchgrass Rhizosphere | MILSDLPTPAEAFVHQSGGRQGFAQAGNRVQLFGIMRYGLNP |
| Ga0157380_125121501 | 3300014326 | Switchgrass Rhizosphere | MRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIM |
| Ga0181525_101594442 | 3300014654 | Bog | MIFSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML* |
| Ga0137409_100379512 | 3300015245 | Vadose Zone Soil | MIFSDLPSPAEASGRMNGWLEGFAQAGNRYPLFGIML* |
| Ga0137403_102843292 | 3300015264 | Vadose Zone Soil | MFAYSWSMIFSDLPSPAEAPSHSSRHRLGFAQAGNRYPLFGIML* |
| Ga0132258_127049972 | 3300015371 | Arabidopsis Rhizosphere | WSMIFSDLASPAEASSHTKFGGQAFAQAGNRYPLFGIML* |
| Ga0132255_1042880721 | 3300015374 | Arabidopsis Rhizosphere | MIFSDLPTPAEASIHMTRPCQGFAQAGNRYPLFGIMLYF |
| Ga0182041_111789903 | 3300016294 | Soil | MIFFRLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML |
| Ga0182033_102178452 | 3300016319 | Soil | MIFSDLASPAEASSETTKPDKGFAQAENRFPLFGIML |
| Ga0182033_113775481 | 3300016319 | Soil | YWWSMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLEHDR |
| Ga0182037_109376832 | 3300016404 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIMR |
| Ga0187802_100001388 | 3300017822 | Freshwater Sediment | MIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML |
| Ga0187806_10473102 | 3300017928 | Freshwater Sediment | MIFSDLPSPAEASNEDTSGWRGFAQAGNRFPLFWIML |
| Ga0187783_100100215 | 3300017970 | Tropical Peatland | MIFSDLASPAEANPPKPSARAGFAKAENRFPLFGIML |
| Ga0187781_101314881 | 3300017972 | Tropical Peatland | MISSDLPSPAEALIYRENRCAGFAQAGNRFPLFGIMR |
| Ga0187781_103023032 | 3300017972 | Tropical Peatland | MIFSDLPSPAEASSQTASRAKGFAQAGNRFPLFGIML |
| Ga0187781_104657352 | 3300017972 | Tropical Peatland | MIFSDLPSPAEASSQTMNRAKGFAQAGNRYPLFGIML |
| Ga0187781_106564252 | 3300017972 | Tropical Peatland | WRMMFSDLLSPAETLRETTNRATGFAQAGNRYPLFGIMR |
| Ga0187782_103687572 | 3300017975 | Tropical Peatland | MIFSDLPSPAEASLQSKGWGEGFAQAGNRYTLFGIMF |
| Ga0187782_104379982 | 3300017975 | Tropical Peatland | MIFSDLPSPAEASNQTMNRPKGFAQAGNRYPLFGIML |
| Ga0187782_105370762 | 3300017975 | Tropical Peatland | MIFSDLPSPAEASTQHEGWCASFAQAGNRYTLFGIML |
| Ga0187782_106121432 | 3300017975 | Tropical Peatland | MIFSDLPSPAEALIRREGGREGYAQAGNRCTLFGIML |
| Ga0187782_112413751 | 3300017975 | Tropical Peatland | MIFSDLPSPAEASIQCERWREGFAQAGNRCTLFGIM |
| Ga0187822_103543992 | 3300017994 | Freshwater Sediment | FSMSMILSDLASPAEASNETAISCGSFAQAGNRHPLFGIMLY |
| Ga0187866_10478581 | 3300018015 | Peatland | MIFSHLPAPADAGFAEAENWNPLFGIMLALARDGAA |
| Ga0184608_104797952 | 3300018028 | Groundwater Sediment | LSDLPSPAEASSQNGEPCQGFAQAGNRFPLFGIMRYLRI |
| Ga0187766_103418052 | 3300018058 | Tropical Peatland | MIFSDLASPAEASSQTMIGATGFAQAGNLYPLFGIML |
| Ga0187784_100051576 | 3300018062 | Tropical Peatland | MIFSDLPSPAEASTQTMNRAKGFAQAGNRHPFFGIML |
| Ga0187784_101406383 | 3300018062 | Tropical Peatland | MIFSDLASLAEAACRHGSDCELTGHAKAGNRYPLFGIML |
| Ga0187773_107718612 | 3300018064 | Tropical Peatland | LFEHDLSDLASPAEAENEDASGLHGFAQAANRRPLFGIML |
| Ga0184617_11655872 | 3300018066 | Groundwater Sediment | SSRSFRLSMIFSDLPTPAEASIHEIGRRQGFAQAGNRYPLFGIML |
| Ga0187772_105088001 | 3300018085 | Tropical Peatland | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGITL |
| Ga0190265_109851532 | 3300018422 | Soil | IFSDLPSPAEAFVHAMGPCQGFAQAGNRCTLFGIML |
| Ga0066662_103478983 | 3300018468 | Grasslands Soil | MIFSDLPSPAEASSQTTNGAKGFAQAGNRFPLFGIML |
| Ga0066669_108425863 | 3300018482 | Grasslands Soil | MIFSDLPSPAEASSETTNRCQGFAQAGNRYPLFGI |
| Ga0210407_113178692 | 3300020579 | Soil | MMFSDLPSPAEASNGTTKVRRGFAQAGNRYSLFGIVL |
| Ga0210401_101244522 | 3300020583 | Soil | MLSWSMIFSDLPSPAEASSQTMKRAMGFAQAGNRVPLFGIML |
| Ga0210401_104588182 | 3300020583 | Soil | MMFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML |
| Ga0210401_109470162 | 3300020583 | Soil | MIFSDLPSPAEASSQTTERAKGYAQAGNRFPLFGIMR |
| Ga0210401_112625761 | 3300020583 | Soil | MIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIML |
| Ga0210401_116105322 | 3300020583 | Soil | DGNDYRSGFWWSMIFSDLPSPGEASNETTNRCLGFAQAGNRYLLFGIML |
| Ga0210404_101298543 | 3300021088 | Soil | MIFSDLASPAEAPSHTMKRTKGFAQAGNRFPLFGIML |
| Ga0210404_104709772 | 3300021088 | Soil | MIFSDLPSPAEASNHTISSAMGFAQAGNRYPLFGIML |
| Ga0210404_105870391 | 3300021088 | Soil | SMIFSDLPSPAEASSQTTDSARGFAQAGNRYPLFGIML |
| Ga0210404_107713142 | 3300021088 | Soil | HPTLAYSWSMIFSDLPSPAEASSETTKHATGLAQAGNRFPLFGTML |
| Ga0210400_107364921 | 3300021170 | Soil | FSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL |
| Ga0210400_107950382 | 3300021170 | Soil | MLSWSMIFSDLPSPAEASSQMMKRAMGFAQAGNRVPLFGIML |
| Ga0210408_100014936 | 3300021178 | Soil | MISCDLPSPAEASTHMMNPTKGFAQAGNRYPFFAIML |
| Ga0210408_1000206116 | 3300021178 | Soil | MMFSDLPSPAEASNHTTSSAAGFAQAGNRYPLFGIML |
| Ga0210408_100030676 | 3300021178 | Soil | MFSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL |
| Ga0213882_101315842 | 3300021362 | Exposed Rock | MIFSDLPSPAEASFRYEKRRDGFAQAGNRYPLFGIMR |
| Ga0213881_100468273 | 3300021374 | Exposed Rock | MIFSDLFSPAEAPSQTTKRANGFAQAGNRFLVFGIML |
| Ga0213881_100943582 | 3300021374 | Exposed Rock | MIFSDLPSPAEASSQTTDRAKGFAQAGNRYPLFGIMR |
| Ga0213881_101057911 | 3300021374 | Exposed Rock | MIFSDLPSPAEASSQTTNSTTGFAQAGNRYPNFGIMRY |
| Ga0213881_101241202 | 3300021374 | Exposed Rock | MIFSDLPSSAEASSQPTKRAKGFAQAGNRCPLFGIMR |
| Ga0213876_100467222 | 3300021384 | Plant Roots | MIFSDLSSPAEASSRHDEMRQGFARAGNRFTLFGIMR |
| Ga0213876_101757941 | 3300021384 | Plant Roots | VFFKAYWSMIFSDLPSPAEASNPTTNSTKGFAQAGNRYPLFGI |
| Ga0213876_101875941 | 3300021384 | Plant Roots | MIFSDLPSPAEASADCEERSNGFAQAGNRHPLFGIML |
| Ga0213875_103903131 | 3300021388 | Plant Roots | MMFSDLPSPAEASSQTTNRATGYAQAGNRYPLFGIML |
| Ga0213875_105885031 | 3300021388 | Plant Roots | ALGYCWSMMFSDLPSPAEASSDTTNSALGFAQAGSR |
| Ga0210383_113904352 | 3300021407 | Soil | MIFSDLSSPAEAASQTTIDSAGFAQAGNRCPLFGIML |
| Ga0210384_101783473 | 3300021432 | Soil | MIFSDLPSPAEASTQNDEPCKGFAQAGNRFPLFGIML |
| Ga0210384_102025623 | 3300021432 | Soil | MIFSDLPSPAEASSQMTEQLQGFAQAGTRSPLFGIML |
| Ga0213879_101703541 | 3300021439 | Bulk Soil | FWSMTFSDLASPAEAPSHMMKATKGFAQAGNRFPLFGIMLYLL |
| Ga0187846_100486212 | 3300021476 | Biofilm | MMFSDLPSPAEASSQLLSRATGFAQAGNRYPLFGIML |
| Ga0187846_102766331 | 3300021476 | Biofilm | YWSMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFRIML |
| Ga0187846_103811842 | 3300021476 | Biofilm | MMFSDLPSPAEASSQLLSRASGFAQAGNRYPLFGIMF |
| Ga0210402_113956012 | 3300021478 | Soil | MIFSDLSSPAEASSRMNGWLEGFAQAGNRYPLFGIML |
| Ga0210409_100081855 | 3300021559 | Soil | MFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML |
| Ga0126371_100259265 | 3300021560 | Tropical Forest Soil | MIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML |
| Ga0212124_106401102 | 3300022553 | Freshwater | MIFSDLPSPAEAGFAKAGNRVPLFGIMLAHAPFQQC |
| Ga0209758_11048271 | 3300025297 | Arabidopsis Rhizosphere | GAALLRWSMIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS |
| Ga0208479_10899931 | 3300025474 | Arctic Peat Soil | MILSDLPSPAEAGFAKAGNRFPLFGIMRLLPIPQHRLNQRQRRHR |
| Ga0207688_101917833 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR |
| Ga0207647_104051942 | 3300025904 | Corn Rhizosphere | MILSDLPAPAEALARVTGSCEGFAQAGNRFTLFGIMRLVTCAAKP |
| Ga0207647_108030211 | 3300025904 | Corn Rhizosphere | VVLRMIFSDLPSPSEAPARTGGLCWGFAQAGNRFPLFGIMRA |
| Ga0207699_105068592 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSRAEGLPKGFAQAGNRCTLFRIMRSERAADRQ |
| Ga0207699_108634982 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSKNEQPCEGFAQAGNRRPLFGIML |
| Ga0207643_102044231 | 3300025908 | Miscanthus Rhizosphere | MIFSDLPSPAEALVYATGPCQGFAQAGNRRPLFGI |
| Ga0207671_103453371 | 3300025914 | Corn Rhizosphere | YCVRMILSDLPTPAEASGHATGPRKGFAQAGNRFTLFESRR |
| Ga0207700_104596881 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASNETTNRCLGFAQAGNRYPLFGIMLRIS |
| Ga0207664_104065731 | 3300025929 | Agricultural Soil | MIFSDLPSPAEAGFAKAGNRYPLFGIMRLRRARERLLSGRR |
| Ga0207664_105685371 | 3300025929 | Agricultural Soil | GHALACCLSMIFSDLPSPAEASSQPTIGATGFAQAGNRYTLFGIML |
| Ga0207706_115235622 | 3300025933 | Corn Rhizosphere | MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLF |
| Ga0207670_113969502 | 3300025936 | Switchgrass Rhizosphere | SMIWSDLPSPAEASVRSVASCQGFAQAGNRFPLFGIMLL |
| Ga0207704_116522262 | 3300025938 | Miscanthus Rhizosphere | YWWSMIISDLPSPAEAFVHTAGLCQGFAQAGNRSTLFGIKH |
| Ga0207658_109564622 | 3300025986 | Switchgrass Rhizosphere | EPGQRSVIRLLIFLSTIFSDLPSPAEAGFAKAGNRFTLFGIMP |
| Ga0207641_115775052 | 3300026088 | Switchgrass Rhizosphere | MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGISG |
| Ga0209055_11114953 | 3300026309 | Soil | MIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML |
| Ga0209807_10546762 | 3300026530 | Soil | MIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML |
| Ga0209474_104613171 | 3300026550 | Soil | LNMIFSNLPSPAEASNETTSRCLGFAQAGNQFPLFGIML |
| Ga0209577_100356972 | 3300026552 | Soil | MSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML |
| Ga0209577_101386142 | 3300026552 | Soil | MMFSDLPSPAEASNGTTKVRRGFAQAGNRYPLFGIVL |
| Ga0209577_101766301 | 3300026552 | Soil | HLYLLIRRAFCLSMIFSDLPSPAEAGFAQAGNRLPLFGIML |
| Ga0209577_104119082 | 3300026552 | Soil | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR |
| Ga0209577_104317062 | 3300026552 | Soil | MIFSDLPSPAEASSQMTPSAKGFAQAGNRYPLFGIMSEAYSTQGVRL |
| Ga0209902_1036723 | 3300026863 | Cyanobacterial | MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML |
| Ga0207834_10257961 | 3300026988 | Tropical Forest Soil | LLQLFVLSMIFSDLASPAVASTERLGRLHGFAQAGNRYPLFGIML |
| Ga0209166_102718652 | 3300027857 | Surface Soil | MIFSDLPSPAEASGRMEGLCGGFAQAGNRFPLFRIMLYDRQ |
| Ga0209579_104040101 | 3300027869 | Surface Soil | TCSDLPSPAEASSQDDQLCQGFAQAGNRHPLFGVML |
| Ga0209465_101160471 | 3300027874 | Tropical Forest Soil | MIFSDLPSPAEASSETTTRNRGFAQAGNRFPPRIK |
| Ga0209465_104961342 | 3300027874 | Tropical Forest Soil | MIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML |
| Ga0209380_101234712 | 3300027889 | Soil | MIFSDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML |
| Ga0209067_109323091 | 3300027898 | Watersheds | LSMIFSDLTSPAEASNETANGWRGFAQAGNRRPLFGIMR |
| Ga0307317_101572632 | 3300028720 | Soil | MIFSDLPSPAEAPIHPRETMLGFAQAGNRRLLFGIMLY |
| Ga0307310_106456701 | 3300028824 | Soil | IFSDLPTPAEASVHEVGRREGFAQAGNRFPLFGIMRL |
| Ga0308309_106296182 | 3300028906 | Soil | MIFSDLASPAEAGFAKAGNRYPLFGIMLCRSVEHRR |
| Ga0308309_111363701 | 3300028906 | Soil | DLPDLPSPAEASNESTRDWLGFAQAGNRYPLFGIML |
| Ga0308309_116484262 | 3300028906 | Soil | MTFLRIVIPLYLIGWSMIFSDLPSPAEAGFAQAGNRCPLFGIML |
| Ga0222749_101662911 | 3300029636 | Soil | LEHDFSDLPSATEASSQATKRAKGFAQAGNQYSLFG |
| Ga0170834_1045484384 | 3300031057 | Forest Soil | AFCLSMIFSDLASPAEASNERASDCRGFAQAGNRHPLFGIKP |
| Ga0170823_159512381 | 3300031128 | Forest Soil | PYHFCLRMIFSDLPSPAEASKERTRDCLGFAQAGNRLPLFGIMR |
| Ga0307497_101709332 | 3300031226 | Soil | MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR |
| Ga0170820_112429083 | 3300031446 | Forest Soil | MIFSDLASPAEALDETISRLHGFAQAGNRRPLFGIML |
| Ga0170820_150653833 | 3300031446 | Forest Soil | MFPLFRIMQFWWSMIFSDLPSPAEASNETTNWCLGFAQAGNRLPLFRIML |
| Ga0318516_107800412 | 3300031543 | Soil | MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIML |
| Ga0318534_105387182 | 3300031544 | Soil | MIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGIVL |
| Ga0318541_100396691 | 3300031545 | Soil | MIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGI |
| Ga0310887_107800362 | 3300031547 | Soil | MILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRL |
| Ga0318573_107340231 | 3300031564 | Soil | SPHSYWWSMIFSDLPSPAEASTHTTDRAKGFAQAGNRSPLFGIML |
| Ga0318560_100843491 | 3300031682 | Soil | MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIMR |
| Ga0265314_1000529912 | 3300031711 | Rhizosphere | MIFSDLPSPAEASSNTKSLGKGFAQAGNRCTLFGIMH |
| Ga0307476_106767401 | 3300031715 | Hardwood Forest Soil | WSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML |
| Ga0307476_107648691 | 3300031715 | Hardwood Forest Soil | AVLYCWSMIFSNLPSPAEASSQNDQPCQGFAQAGNRCPLFGIML |
| Ga0307474_110783601 | 3300031718 | Hardwood Forest Soil | YWWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML |
| Ga0307469_112346811 | 3300031720 | Hardwood Forest Soil | MICSDLPSPAEASGHTTGLCKGVAQPGNRYALFGIML |
| Ga0307469_119191282 | 3300031720 | Hardwood Forest Soil | MMFSDLPSPAEASSQMKNRAKGFAQAGNQYPLFGIML |
| Ga0307516_107619311 | 3300031730 | Ectomycorrhiza | VFSDLPSPAEASVRTMGPSQGFAQAGNRCTLFGIMF |
| Ga0306918_113383551 | 3300031744 | Soil | LWSMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML |
| Ga0307477_103908643 | 3300031753 | Hardwood Forest Soil | HCWSMIFSDLPSPAEASSQVTTGATGFAQAGNRYPLFGIMLY |
| Ga0307477_107998741 | 3300031753 | Hardwood Forest Soil | MILTDPASLASPAEASTAITSRWHGFAQAGNRHPLFGIMLGS |
| Ga0318554_105857792 | 3300031765 | Soil | DYVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR |
| Ga0318509_104523112 | 3300031768 | Soil | YVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR |
| Ga0318509_104914781 | 3300031768 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRCPLFGIML |
| Ga0318552_105263541 | 3300031782 | Soil | LFVLSMIFSNLASPAVTSTERLGRLHGFAQAGNRYPLFGIML |
| Ga0318550_101293202 | 3300031797 | Soil | MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIM |
| Ga0307473_114480761 | 3300031820 | Hardwood Forest Soil | YWRMILSDLPSPAEASSHTTTSASGFAQAGNRFPLFGIMR |
| Ga0307478_104656321 | 3300031823 | Hardwood Forest Soil | MIFSELPSPAEASSQNNQPCQGFAQAGNRYPLFGI |
| Ga0307478_105957691 | 3300031823 | Hardwood Forest Soil | WWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML |
| Ga0307478_115476692 | 3300031823 | Hardwood Forest Soil | MIFSDLPSPAEASSQNDQPCQGFAQAGNRYPLFGI |
| Ga0318511_104394772 | 3300031845 | Soil | VLSMIFSELASPAAASTERLGRLHGFAQAGNRYPLFGIML |
| Ga0310904_106343181 | 3300031854 | Soil | MILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRLVTCAAKQA |
| Ga0310892_112904341 | 3300031858 | Soil | ALCLSMIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML |
| Ga0306919_112061371 | 3300031879 | Soil | MIFSDLPSPAEASSLTTDRAKGFAQAGNRRPLFRIMLLPIS |
| Ga0306925_119489661 | 3300031890 | Soil | MIFSDLASPAGALTEWAGRWQGFAQAGTRYPLFGIVLGALSAGGRSS |
| Ga0306921_108312752 | 3300031912 | Soil | MIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIML |
| Ga0306921_117517751 | 3300031912 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML |
| Ga0310912_112035291 | 3300031941 | Soil | AFCLSMTLSDLASPAEASNGRNRDWRGFAQAGNRFSVFGIML |
| Ga0306926_113609572 | 3300031954 | Soil | MILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLSGIMLEHDR |
| Ga0318530_102152192 | 3300031959 | Soil | VLLQLFVLSMIFSDLASPAAASTERLGRLHGFAQAGNRYPLFGIML |
| Ga0318559_104608972 | 3300032039 | Soil | MIFSDLPSLAEASSHWDGLRQGFAQAGNRRPLFGIML |
| Ga0318533_107905541 | 3300032059 | Soil | SMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML |
| Ga0318533_108017562 | 3300032059 | Soil | MILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLFGIMLEHDR |
| Ga0318553_106313022 | 3300032068 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIML |
| Ga0306924_122399252 | 3300032076 | Soil | MIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIMLY |
| Ga0307470_101127092 | 3300032174 | Hardwood Forest Soil | MIFSDLPSPTEASGHTTGLCKGVAQAGNRYALFGIML |
| Ga0307470_118535451 | 3300032174 | Hardwood Forest Soil | MIFSDLPSPAEASSRAEGLKGFAQAGNRCTLFRIMRSERAADR |
| Ga0307472_1004797272 | 3300032205 | Hardwood Forest Soil | MIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML |
| Ga0307472_1012466472 | 3300032205 | Hardwood Forest Soil | MIFSDLPSPAEAASQTTSGATGFAQAGNRFPLFGIMR |
| Ga0307472_1020258902 | 3300032205 | Hardwood Forest Soil | MIISDLPSPAEAPSQTTDRERGFAQAGNRFPLFGIML |
| Ga0306920_1021388391 | 3300032261 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGI |
| Ga0335081_1000084528 | 3300032892 | Soil | MIFSDLPSPAEAPTQVINGSQGFAQAANRCTLFAIML |
| Ga0335081_107012642 | 3300032892 | Soil | MIFSDLPSPAEASSNTKNLTKGFAQAGNRFPLFGIMREHHAPAP |
| Ga0335083_114066952 | 3300032954 | Soil | MIFSDLASPAEAGFAKAGNRFPLFRIMLAIQAIRQMTKAR |
| Ga0335084_114348612 | 3300033004 | Soil | MIFSGQASPAEAFFHIEGVRPGFAQAGNRYPLFGIML |
| Ga0335077_107682102 | 3300033158 | Soil | MILSDLPSPAEASSQTKKSAKGFAQAENRFPLFGIML |
| Ga0335077_108762792 | 3300033158 | Soil | MIFSDLASPAEAPSHTTVRAMGFAQAGNRFPLFGIML |
| Ga0335077_111523562 | 3300033158 | Soil | MIFSGPPSPAEASLGMSSRAAGFAQAGNQYPLFGIMF |
| Ga0310914_100458083 | 3300033289 | Soil | MIVSDLPSSAEAGNEDAGGWHGFAQAGNRLPLFGIML |
| Ga0247829_105083012 | 3300033550 | Soil | MSCSDLPSHAENQNNDPCQGFAQAGNRFSLFRDMR |
| Ga0370498_066558_659_772 | 3300034155 | Untreated Peat Soil | MILSDLPTPAEAFVNEIGRHQGFAQAGNRFPLFGIML |
| Ga0370498_134200_11_124 | 3300034155 | Untreated Peat Soil | MILSDLPSPAEASSHNNDPCQGFAQAGNRIPLFGIML |
| ⦗Top⦘ |