NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026863

3300026863: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026863 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110132 | Gp0095973 | Ga0209902
Sample NameCyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size118759663
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCyanobacterial Communities From The Joint Genome Institute, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → microbial mat material
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.9313884Long. (o)-122.0239394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008003Metagenome / Metatranscriptome341Y
F023883Metagenome / Metatranscriptome208Y
F059129Metagenome / Metatranscriptome134Y
F078433Metagenome / Metatranscriptome116Y
F098177Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209902_102581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4899Open in IMG/M
Ga0209902_102680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4665Open in IMG/M
Ga0209902_103672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3159Open in IMG/M
Ga0209902_105759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1835Open in IMG/M
Ga0209902_106834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1488Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209902_102581Ga0209902_1025812F059129MRTAIFAAAAACLIAVPATAGEVRSTDMSSQGVYIEGPGVGVRVGPDRPRYREGWRERQVRGGGGCKTVTVRETMPDGTRVKRTRSNC
Ga0209902_102680Ga0209902_1026807F098177MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK
Ga0209902_103672Ga0209902_1036723F008003MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML
Ga0209902_105759Ga0209902_1057594F078433LLMSGALYDPPRVINHLGPQASAVGWQIASTLRMW
Ga0209902_106834Ga0209902_1068342F023883MPPAPKRKPADDPTAPDPDKNARLETYEQEVERASVDSIAEHPDGSAPPLERLVDAHPEKQRKPLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.