


| Basic Information | |
|---|---|
| Family ID | F043157 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSILDERFRDCICLNIYDRIDSMQMLGELIMIKRAKSLERRIR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.26 % |
| % of genes near scaffold ends (potentially truncated) | 25.48 % |
| % of genes from short scaffolds (< 2000 bps) | 78.34 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.255 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (14.650 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.032 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (34.395 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF01502 | PRA-CH | 5.10 |
| PF09479 | Flg_new | 5.10 |
| PF00977 | His_biosynth | 1.91 |
| PF01797 | Y1_Tnp | 1.27 |
| PF01833 | TIG | 0.64 |
| PF01144 | CoA_trans | 0.64 |
| PF07581 | Glug | 0.64 |
| PF13540 | RCC1_2 | 0.64 |
| PF01713 | Smr | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 5.10 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.27 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.64 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.64 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.53 % |
| Unclassified | root | N/A | 18.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001371|BBDRAFT_10354051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1551 | Open in IMG/M |
| 3300001751|JGI2172J19969_10116782 | Not Available | 766 | Open in IMG/M |
| 3300001752|JGI2173J19968_10123285 | Not Available | 741 | Open in IMG/M |
| 3300002053|SMTZ23_10025351 | All Organisms → cellular organisms → Bacteria | 8282 | Open in IMG/M |
| 3300004029|Ga0055442_10290312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 560 | Open in IMG/M |
| 3300004324|Ga0066229_100145 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300004324|Ga0066229_100707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300004324|Ga0066229_102258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 749 | Open in IMG/M |
| 3300004324|Ga0066229_102424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300004324|Ga0066229_103416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 646 | Open in IMG/M |
| 3300004326|Ga0066230_101107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 979 | Open in IMG/M |
| 3300004326|Ga0066230_104110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 618 | Open in IMG/M |
| 3300004331|Ga0066232_102219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 777 | Open in IMG/M |
| 3300004331|Ga0066232_102656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300004333|Ga0066237_100586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300004336|Ga0066242_1000502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1284 | Open in IMG/M |
| 3300004336|Ga0066242_1000650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → Spongiibacter tropicus | 1176 | Open in IMG/M |
| 3300004336|Ga0066242_1003560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 704 | Open in IMG/M |
| 3300004338|Ga0066227_1004668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 657 | Open in IMG/M |
| 3300004338|Ga0066227_1009975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 506 | Open in IMG/M |
| 3300004340|Ga0066239_1006735 | Not Available | 590 | Open in IMG/M |
| 3300004341|Ga0066228_1009714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 508 | Open in IMG/M |
| 3300005821|Ga0078746_1031191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1119 | Open in IMG/M |
| 3300005821|Ga0078746_1108680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
| 3300005822|Ga0078744_1008029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2387 | Open in IMG/M |
| 3300005822|Ga0078744_1051406 | Not Available | 927 | Open in IMG/M |
| 3300005822|Ga0078744_1068372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 810 | Open in IMG/M |
| 3300005822|Ga0078744_1120944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 624 | Open in IMG/M |
| 3300005823|Ga0078745_1107836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 791 | Open in IMG/M |
| 3300005832|Ga0074469_10417295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1402 | Open in IMG/M |
| 3300007900|Ga0111031_1004056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1652 | Open in IMG/M |
| 3300009039|Ga0105152_10349463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 619 | Open in IMG/M |
| 3300009150|Ga0114921_11048281 | Not Available | 608 | Open in IMG/M |
| 3300009509|Ga0123573_10531239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1117 | Open in IMG/M |
| 3300009509|Ga0123573_10600914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1040 | Open in IMG/M |
| 3300009529|Ga0114919_10342141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1045 | Open in IMG/M |
| 3300009581|Ga0115600_1113343 | Not Available | 587 | Open in IMG/M |
| 3300009582|Ga0115601_1079773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 987 | Open in IMG/M |
| 3300010413|Ga0136851_10225744 | Not Available | 1923 | Open in IMG/M |
| 3300010995|Ga0139323_128374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 833 | Open in IMG/M |
| 3300010997|Ga0139324_1061328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 856 | Open in IMG/M |
| 3300011118|Ga0114922_10248154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1493 | Open in IMG/M |
| 3300011118|Ga0114922_11263084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 596 | Open in IMG/M |
| 3300012931|Ga0153915_10919446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1017 | Open in IMG/M |
| 3300012931|Ga0153915_11145662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 908 | Open in IMG/M |
| 3300012931|Ga0153915_11917870 | Not Available | 693 | Open in IMG/M |
| 3300012931|Ga0153915_13090490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 541 | Open in IMG/M |
| 3300012964|Ga0153916_10095814 | Not Available | 2800 | Open in IMG/M |
| 3300012964|Ga0153916_10549244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1229 | Open in IMG/M |
| 3300012964|Ga0153916_10685564 | Not Available | 1103 | Open in IMG/M |
| 3300012964|Ga0153916_11449266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 762 | Open in IMG/M |
| 3300012964|Ga0153916_11629887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 719 | Open in IMG/M |
| 3300012964|Ga0153916_13072528 | Not Available | 525 | Open in IMG/M |
| 3300013078|Ga0153914_1245157 | Not Available | 825 | Open in IMG/M |
| 3300013078|Ga0153914_1287828 | Not Available | 560 | Open in IMG/M |
| 3300013080|Ga0153913_1221425 | Not Available | 565 | Open in IMG/M |
| 3300013080|Ga0153913_1295086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 722 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10033540 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10037186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3320 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10116340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1694 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10348283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 874 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10537399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 672 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10714228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 567 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10235826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1158 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10390185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 849 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10805045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 625 | Open in IMG/M |
| 3300017963|Ga0180437_10015698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 8641 | Open in IMG/M |
| 3300017963|Ga0180437_10075321 | Not Available | 2969 | Open in IMG/M |
| 3300017963|Ga0180437_10177068 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1701 | Open in IMG/M |
| 3300017971|Ga0180438_10036061 | All Organisms → cellular organisms → Bacteria | 4954 | Open in IMG/M |
| 3300017971|Ga0180438_10088492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2703 | Open in IMG/M |
| 3300018080|Ga0180433_11104917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300018089|Ga0187774_10026087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2369 | Open in IMG/M |
| 3300019234|Ga0172288_1082535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1120 | Open in IMG/M |
| 3300019234|Ga0172288_1187840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 869 | Open in IMG/M |
| 3300019234|Ga0172288_1484478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1144 | Open in IMG/M |
| 3300019234|Ga0172288_1487393 | Not Available | 628 | Open in IMG/M |
| 3300019245|Ga0187791_1294130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300019246|Ga0172287_1147594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300019246|Ga0172287_1209055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 825 | Open in IMG/M |
| 3300019246|Ga0172287_1224023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 587 | Open in IMG/M |
| 3300019246|Ga0172287_1320053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 607 | Open in IMG/M |
| 3300019250|Ga0187790_1019799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 637 | Open in IMG/M |
| 3300019250|Ga0187790_1395889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 880 | Open in IMG/M |
| 3300019252|Ga0172286_1440818 | Not Available | 643 | Open in IMG/M |
| 3300019252|Ga0172286_1501323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 586 | Open in IMG/M |
| 3300022185|Ga0079039_1419248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 509 | Open in IMG/M |
| 3300022208|Ga0224495_10008300 | All Organisms → cellular organisms → Bacteria | 5648 | Open in IMG/M |
| 3300024433|Ga0209986_10103682 | Not Available | 1541 | Open in IMG/M |
| 3300025794|Ga0209102_1008642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2852 | Open in IMG/M |
| 3300027740|Ga0214474_1029184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2151 | Open in IMG/M |
| 3300027742|Ga0209121_10223793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 659 | Open in IMG/M |
| 3300027811|Ga0256868_10387005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
| 3300027814|Ga0209742_10232409 | Not Available | 606 | Open in IMG/M |
| 3300027888|Ga0209635_10135252 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300027888|Ga0209635_10639051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 788 | Open in IMG/M |
| 3300027888|Ga0209635_10906553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
| 3300027893|Ga0209636_10597646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 888 | Open in IMG/M |
| 3300027893|Ga0209636_11274041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 511 | Open in IMG/M |
| 3300027900|Ga0209253_10264806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1347 | Open in IMG/M |
| 3300027901|Ga0209427_10727855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 712 | Open in IMG/M |
| 3300027917|Ga0209536_100082328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4124 | Open in IMG/M |
| 3300029827|Ga0134606_10019710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2454 | Open in IMG/M |
| 3300030613|Ga0299915_10476771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 823 | Open in IMG/M |
| 3300030714|Ga0307925_106772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1414 | Open in IMG/M |
| 3300030717|Ga0307927_1027313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
| 3300031255|Ga0315554_1057565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1545 | Open in IMG/M |
| 3300031257|Ga0315555_1241898 | Not Available | 699 | Open in IMG/M |
| 3300031356|Ga0307439_1020891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2761 | Open in IMG/M |
| 3300031358|Ga0307438_1014572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3320 | Open in IMG/M |
| 3300031554|Ga0315544_1001442 | All Organisms → cellular organisms → Bacteria | 18517 | Open in IMG/M |
| 3300031620|Ga0315552_1230078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300031698|Ga0315537_1029514 | Not Available | 3251 | Open in IMG/M |
| 3300031746|Ga0315293_10594670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 839 | Open in IMG/M |
| 3300031772|Ga0315288_10033819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6223 | Open in IMG/M |
| 3300031885|Ga0315285_10008069 | All Organisms → cellular organisms → Bacteria | 10811 | Open in IMG/M |
| 3300031952|Ga0315294_10016308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8104 | Open in IMG/M |
| 3300031952|Ga0315294_10128507 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2594 | Open in IMG/M |
| 3300032020|Ga0315296_10009978 | All Organisms → cellular organisms → Bacteria | 7233 | Open in IMG/M |
| 3300032029|Ga0315546_1003832 | All Organisms → cellular organisms → Bacteria | 7906 | Open in IMG/M |
| 3300032046|Ga0315289_10210659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2110 | Open in IMG/M |
| 3300032046|Ga0315289_10527372 | Not Available | 1125 | Open in IMG/M |
| 3300032143|Ga0315292_11427738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 563 | Open in IMG/M |
| 3300032156|Ga0315295_10275662 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300032156|Ga0315295_11096658 | Not Available | 785 | Open in IMG/M |
| 3300032168|Ga0316593_10005239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3402 | Open in IMG/M |
| 3300032168|Ga0316593_10007060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3066 | Open in IMG/M |
| 3300032168|Ga0316593_10018192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2156 | Open in IMG/M |
| 3300032168|Ga0316593_10019419 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300032168|Ga0316593_10028812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1792 | Open in IMG/M |
| 3300032168|Ga0316593_10047568 | Not Available | 1443 | Open in IMG/M |
| 3300032168|Ga0316593_10074919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1174 | Open in IMG/M |
| 3300032168|Ga0316593_10093563 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300032168|Ga0316593_10140481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 875 | Open in IMG/M |
| 3300032168|Ga0316593_10190031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
| 3300032168|Ga0316593_10306291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 602 | Open in IMG/M |
| 3300032168|Ga0316593_10320184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 589 | Open in IMG/M |
| 3300032168|Ga0316593_10386591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300032168|Ga0316593_10452452 | Not Available | 501 | Open in IMG/M |
| 3300033416|Ga0316622_100812250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1087 | Open in IMG/M |
| 3300033480|Ga0316620_10016596 | All Organisms → cellular organisms → Bacteria | 4246 | Open in IMG/M |
| 3300033480|Ga0316620_10115678 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300033513|Ga0316628_100104318 | All Organisms → cellular organisms → Bacteria | 3189 | Open in IMG/M |
| 3300033524|Ga0316592_1044264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 989 | Open in IMG/M |
| 3300033524|Ga0316592_1071836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 783 | Open in IMG/M |
| 3300033528|Ga0316588_1057028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 951 | Open in IMG/M |
| 3300033528|Ga0316588_1132048 | Not Available | 635 | Open in IMG/M |
| 3300033528|Ga0316588_1142098 | Not Available | 614 | Open in IMG/M |
| 3300033529|Ga0316587_1019960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1136 | Open in IMG/M |
| 3300033529|Ga0316587_1055827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 727 | Open in IMG/M |
| 3300033541|Ga0316596_1014959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1930 | Open in IMG/M |
| 3300033541|Ga0316596_1189401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 571 | Open in IMG/M |
| 3300033991|Ga0334965_0275285 | Not Available | 649 | Open in IMG/M |
| 3300034083|Ga0373901_083391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 656 | Open in IMG/M |
| 3300034089|Ga0373913_0081424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 862 | Open in IMG/M |
| 3300034089|Ga0373913_0108542 | Not Available | 759 | Open in IMG/M |
| 3300034191|Ga0373909_0103133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 861 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 14.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 13.38% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment | 10.83% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 7.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 6.37% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 6.37% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.73% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.82% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 3.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.18% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.55% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 2.55% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.91% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.91% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.27% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.27% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.64% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.64% |
| Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 0.64% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.64% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.64% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 0.64% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
| 3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300004324 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1C | Environmental | Open in IMG/M |
| 3300004326 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2A | Environmental | Open in IMG/M |
| 3300004331 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2C | Environmental | Open in IMG/M |
| 3300004333 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC3C | Environmental | Open in IMG/M |
| 3300004336 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4C | Environmental | Open in IMG/M |
| 3300004338 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1A | Environmental | Open in IMG/M |
| 3300004340 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4A | Environmental | Open in IMG/M |
| 3300004341 | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1B | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005822 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1 | Environmental | Open in IMG/M |
| 3300005823 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, MM2 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300007900 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010995 | ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025794 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300030714 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - UN-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030717 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - UN-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
| 3300031356 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90 | Environmental | Open in IMG/M |
| 3300031358 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-110 | Environmental | Open in IMG/M |
| 3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
| 3300031620 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70 | Environmental | Open in IMG/M |
| 3300031698 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032029 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-170 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| 3300034083 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2 | Engineered | Open in IMG/M |
| 3300034089 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.2 | Engineered | Open in IMG/M |
| 3300034191 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBDRAFT_103540512 | 3300001371 | Marine Estuarine | MVGDRLMSILDERFRDCICLNIYDRIDSMRMLGELIMITRAKSLERRIR* |
| JGI2172J19969_101167823 | 3300001751 | Marine Sediment | MVGERLMSISDERFRNCVCLNIYDRIDSMPMLGELIMINGANSLERRIR* |
| JGI2173J19968_101232851 | 3300001752 | Marine Sediment | KLMGISDERFRNCVCLNIYDRIDSMLMLGELIMINGANSLERRIR* |
| SMTZ23_100253517 | 3300002053 | Marine Sediment | MSILDERFRDCICLNIYDGIDSMRMLGELVMRKRAKSLERRIR* |
| Ga0055442_102903122 | 3300004029 | Natural And Restored Wetlands | MSILDERFRNCICLSNYSRIESMQMLGELVMIERAKSLERRIR* |
| Ga0066229_1001453 | 3300004324 | Mangrove Sediment | MGILDERFRGCICLKICDRIESMQMLGELITMKRAKSLERRIR* |
| Ga0066229_1007071 | 3300004324 | Mangrove Sediment | LMGILDEHFRDCICLRMGDRIDSMQMLGEIVMIRRAKSLERRIR* |
| Ga0066229_1022581 | 3300004324 | Mangrove Sediment | VVGDRLISILDERFRNCICLSIYDRIESMRMPGELIVIKRAKSLERRIR* |
| Ga0066229_1024242 | 3300004324 | Mangrove Sediment | MVGDRLMSIFDEHFRNCICLNIYERIYGMQMLGESIMIKMAKGLERRIS* |
| Ga0066229_1034162 | 3300004324 | Mangrove Sediment | MGILDEHFRDCICLNIYDRIDSMQMLGESIMIKWAESLERRIR* |
| Ga0066230_1011072 | 3300004326 | Mangrove Sediment | VVGDRLMSILDERFRDCICLNMYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0066230_1041102 | 3300004326 | Mangrove Sediment | MGILDERFRDCICLNMYDRIDSMQMLGELTMIKRAKSLERRIR |
| Ga0066232_1022192 | 3300004331 | Mangrove Sediment | MRILDERFRNYICLNIYDRIDSMKMLGELIMIKGANSLERRIR* |
| Ga0066232_1026561 | 3300004331 | Mangrove Sediment | MRILGEHFRDCICPNIYHRIDSMQMRGELIMIKWAKSLERRIR* |
| Ga0066237_1005861 | 3300004333 | Mangrove Sediment | VDGDIPMSILDERFRNCICLSNYNRIESMQMLGELIIIERAKSLERRIR* |
| Ga0066242_10005022 | 3300004336 | Mangrove Sediment | MGGERLMSILDERFRDCICLKIYDRTDSMRVLGELIMIKGAKSLERRIR* |
| Ga0066242_10006503 | 3300004336 | Mangrove Sediment | MSILDERFRDCICLNIYDRINSMQMLGELIMTNRAKSLERR |
| Ga0066242_10035601 | 3300004336 | Mangrove Sediment | MSILDERFRNCICLSIYDRIESMRMPGELLMIKRAKSLERR |
| Ga0066227_10046682 | 3300004338 | Mangrove Sediment | VVGDRLMGILDERFRNCMCLNMYDRIDGMQMLGELVIIKRAKSLERRIR* |
| Ga0066227_10099752 | 3300004338 | Mangrove Sediment | MGILDEHFRNCICLRIGDRIDSMQMLGEIVMIERAKSLERRIR* |
| Ga0066239_10067352 | 3300004340 | Mangrove Sediment | IFDERFRDCICLNIYDRIDGMQMPGESIMIKMAKGLERRIS* |
| Ga0066228_10097141 | 3300004341 | Mangrove Sediment | MSILDELFRNCICLNIYDRIESMRMLEGLLMIKRAKSLERRIR* |
| Ga0078746_10311912 | 3300005821 | Marine Sediment | VVGDRLMSILDEHFRNCICLNIYDRIESMQMLGELIMTNRAKSLERRIR* |
| Ga0078746_11086802 | 3300005821 | Marine Sediment | VVGDKLMGILDERFRDCICLNIYDRIESMQMLGELIMTNRAKSLERRIR* |
| Ga0078744_10080293 | 3300005822 | Marine Sediment | MSILDEHFRNCICLNIYDRIESMQMLGELIMTNRAKSLERRIR* |
| Ga0078744_10514062 | 3300005822 | Marine Sediment | ESGFYRPGCRHIRLEPRFVVGDKLMGILDERFRNCICLKTYDRIESMQMLGELTMIKRAKSLERRIR* |
| Ga0078744_10683722 | 3300005822 | Marine Sediment | MGILDERFRDCICLNIYDRIDSMQMLGELIMTNRAKSLERRIR* |
| Ga0078744_11209442 | 3300005822 | Marine Sediment | MSILDEHFRDCICLRIGDRIDSMQMLGELIMEKRAKSLERRIR* |
| Ga0078745_11078362 | 3300005823 | Marine Sediment | VVGDRLMSILDEHFRDCICLRIGDRIDSMQMLGELIMEKRAKSLERRIR* |
| Ga0074469_104172952 | 3300005832 | Sediment (Intertidal) | MVGDRLMNISDERFRDRICLNIYDRIDSMQMLGELIMIKGAKSLERRIR* |
| Ga0111031_10040563 | 3300007900 | Marine Sediment | VVGDRLMGILDERFRDCICLNIYDRINSMQMLGELMMTNRAKSLERRIR* |
| Ga0105152_103494632 | 3300009039 | Lake Sediment | MGILDERFRDCICLNIYDRIDSMQMLGELIMIKRAKKLERRIR* |
| Ga0114921_110482812 | 3300009150 | Deep Subsurface | MVGERLMRISDDRFRNCVCLNIYNYNRIDCMRMLGELIMIKRTKSLERRIR* |
| Ga0123573_105312392 | 3300009509 | Mangrove Sediment | VAGDTVMSILDEHFRDCICLNIYDGINSMRMLGELVMIKRAKSLERRIR* |
| Ga0123573_106009142 | 3300009509 | Mangrove Sediment | VGGDTLVSILDERFRDCICLSNYNRIESMQMLGELIMIERAKSLERRIR* |
| Ga0114919_103421412 | 3300009529 | Deep Subsurface | MSILDEHFRDCICLNIYNYNRIDCMRMLGELIMIKRTKSLERRIR* |
| Ga0115600_11133431 | 3300009581 | Wetland | ISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0115601_10797731 | 3300009582 | Wetland | MGISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0136851_102257441 | 3300010413 | Mangrove Sediment | MSILDERFRNCICLSNYNRIESMQMLGELIMIERAKSLERRI |
| Ga0139323_1283742 | 3300010995 | Sediment | MSILDERFRDCICLNIYDRIDSMQMLGELIMIKRAKSLERRIR* |
| Ga0139324_10613282 | 3300010997 | Sediment | MVGERLMRILDERFRNCICLNIYDRIDSMQMLGELIMIRRAKSLERRIR* |
| Ga0114922_102481542 | 3300011118 | Deep Subsurface | MGISDERFRDCICLNIYDRINSMQMLGELTMIKGVKSLERRIR* |
| Ga0114922_112630842 | 3300011118 | Deep Subsurface | VVGDKLMGILDERFRNCICLKTYDRIESMQMLGELTMIKRAKSLERRIR* |
| Ga0153915_109194461 | 3300012931 | Freshwater Wetlands | MSILDERFRDYICLNIYDRIDSMQMLGELIMIKRAKSLERRIR* |
| Ga0153915_111456621 | 3300012931 | Freshwater Wetlands | MGISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRI |
| Ga0153915_119178702 | 3300012931 | Freshwater Wetlands | FMVGDRLMGILDEHFRDGICLNIYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0153915_130904902 | 3300012931 | Freshwater Wetlands | MRISDERFRDCICLNIYDRIDSMQMLGELVMIKRAK |
| Ga0153916_100958144 | 3300012964 | Freshwater Wetlands | MGIFDEHFRDCICLNIYDRIDSMQMLEGLVMIKRAKSLERRIR* |
| Ga0153916_105492442 | 3300012964 | Freshwater Wetlands | MGILDEHFRDCICLNIYDRIDSMQMLRLIAIKRAKSLERRIR* |
| Ga0153916_106855642 | 3300012964 | Freshwater Wetlands | LELRFMVGDRLMRIADERFRDCICLNIYDRIDSMQMLGEFVMIKRAKSLERRIR* |
| Ga0153916_114492661 | 3300012964 | Freshwater Wetlands | MRIADERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLER |
| Ga0153916_116298871 | 3300012964 | Freshwater Wetlands | MSILDERFRDCICLNIYDRIDSMQMLESIMIKRAKSLERRIR* |
| Ga0153916_130725281 | 3300012964 | Freshwater Wetlands | RFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0153914_12451573 | 3300013078 | Freshwater Wetlands | DCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR* |
| Ga0153914_12878282 | 3300013078 | Freshwater Wetlands | MVVDRLMRISDERFRDCICLNIYDRIDSMQMLRELVMIKRAKSLERRIR* |
| Ga0153913_12214251 | 3300013080 | Freshwater Wetlands | SDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSFERRIR* |
| Ga0153913_12950862 | 3300013080 | Freshwater Wetlands | MSILDERFRDCTCLNIYDRIDSMQMLELIVIKRAKSLERRIS* |
| (restricted) Ga0172365_100335403 | 3300013127 | Sediment | MGILDEHFRDCICLNIYDRIESMQMREELVMIKRAKSLERRIR* |
| (restricted) Ga0172365_100371867 | 3300013127 | Sediment | CRHIRLEPRVVVGDRLMGILDERFRDCICLNIYDRIDSMRVLGELIMANRAKSLERRIR* |
| (restricted) Ga0172365_101163402 | 3300013127 | Sediment | MGILDERFRDCICLNIYDRIDSMRVLGELLMANRAKSLERRIR* |
| (restricted) Ga0172365_103482832 | 3300013127 | Sediment | MGILDERFRDCICLNICDGIKSMQMLGELTMIKRAKSLERRIR* |
| (restricted) Ga0172365_105373992 | 3300013127 | Sediment | MVGDRLMSILDEHFRDCICLNICDRIESMQMREELVMIKRAKS |
| (restricted) Ga0172365_107142281 | 3300013127 | Sediment | MGILDEHFRDCICLNIYDRIESMKMLGESIMIKRAKSLERRIR* |
| (restricted) Ga0172366_102358263 | 3300013128 | Sediment | MSILDEHFRDCICLNIYDRIDSMQMREELVMIKRAKSLERRIR* |
| (restricted) Ga0172366_103901852 | 3300013128 | Sediment | VVGDRLMGKLDERFRDCICLNIYDRIDSMRVLGESIMANRAKSLERRIR* |
| (restricted) Ga0172362_108050452 | 3300013133 | Sediment | MVGDRLMSILDEHFRDCICLNIYDGIDSMRVLGESIMANRAKSLERRIR* |
| Ga0180437_100156983 | 3300017963 | Hypersaline Lake Sediment | MGILDERFRNCICLNMYDRIESMRVLGELIMIKRAKSLERRIR |
| Ga0180437_100753213 | 3300017963 | Hypersaline Lake Sediment | MSILDERFRNCICLSVYNRIESMQMLGELVMIERAKSLERRIR |
| Ga0180437_101770682 | 3300017963 | Hypersaline Lake Sediment | VVGDRVMSILDEHFRNCICLNIYDRINSMQMLGELIMIKGAKSLERRIR |
| Ga0180438_100360612 | 3300017971 | Hypersaline Lake Sediment | MGILDERFRNCICLNMYDRIESMRVLGELVMIKRAKSLERRIR |
| Ga0180438_100884924 | 3300017971 | Hypersaline Lake Sediment | VDGDIPMSILDERFRNCICLSVYNRIESMQMLGELVMIERAKSLERRIR |
| Ga0180433_111049172 | 3300018080 | Hypersaline Lake Sediment | MSILDEHFRNCICLNIYDRINSMQMLGELIMIKGAKSLERRIR |
| Ga0187774_100260872 | 3300018089 | Tropical Peatland | MVGERLMSILDERFRDCICLNIYDRIDSMQMLELIMIKRAKSLERRIR |
| Ga0172288_10825352 | 3300019234 | Wetland | MGILDERFRDGICLNIYDRIDSMQMLGELIMINRAKSLERRIR |
| Ga0172288_11878401 | 3300019234 | Wetland | MGILDERFRECICLNIYDRIDSMQMLRELVMIKRVKSLERRIR |
| Ga0172288_14844782 | 3300019234 | Wetland | MVGERLMSILDERFRDYICLNIYDRIDSMQMLGELIMIKRAKSLERRIR |
| Ga0172288_14873931 | 3300019234 | Wetland | LELRFMVGDRLMRIADERFRDCICLNIYDRIDSMQMLGEFVMIKRAKSLERRIR |
| Ga0187791_12941302 | 3300019245 | Peatland | MVADRLMSILDERFRDCICLNIYDRIDSMQMLELIMIKRAKSLERRIR |
| Ga0172287_11475941 | 3300019246 | Wetland | MVGDRLMGISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0172287_12090552 | 3300019246 | Wetland | VVGDRLMGILDERFRECICLNIYDRIDSMQMLRELVMIKRVKSLERRIR |
| Ga0172287_12240231 | 3300019246 | Wetland | VVGDRLMRISDERFRDCICLNIYDRIDSMQMLRELVMIKRAKSLERRIR |
| Ga0172287_13200532 | 3300019246 | Wetland | MGILDERFRDGICLNIYDRIDSMQMLGELIMIKRAKSLERRIR |
| Ga0187790_10197992 | 3300019250 | Peatland | MVGEKLMGILDERFRDCICLNIYDRTDSMRMLELITIKRARSLERRIR |
| Ga0187790_13958892 | 3300019250 | Peatland | MRISDERFRNCVCLNIYNRIDCMRMLGELIIIRAKSLERRIR |
| Ga0172286_14408182 | 3300019252 | Wetland | LEPRFVVGDRLMGILDERFRDGICLNIYDRIDSMQMLGELIMINRAKSLERRIR |
| Ga0172286_15013232 | 3300019252 | Wetland | MVGERLMSILDERFRDYICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0079039_14192482 | 3300022185 | Freshwater Wetlands | MVGDRLMRISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERR |
| Ga0224495_100083005 | 3300022208 | Sediment | MVGDRLMRISDERFRDCICLSIYGRIDSMQMLGELIMIKGAKSLERRIR |
| Ga0209986_101036822 | 3300024433 | Deep Subsurface | MVGERLMRISDERFRNCVCLKMYNMIDCMRMLGELIMIKRTKSLERRIR |
| Ga0209102_10086423 | 3300025794 | Hot Spring Microbial Mat | MRIQGKCFRNCVCLSIQKRTERMQRELIIISRAKSLERRIR |
| Ga0214474_10291843 | 3300027740 | Soil | MGILDERFRDCICLNIYDRIDSMQMLGELIMIKRAKKLERRIR |
| Ga0209121_102237932 | 3300027742 | Marine | MVGERLMSILDERFRKYVCLNIYERIDSMQMLGELIEIRAKSLERRIR |
| Ga0256868_103870051 | 3300027811 | Soil | VVGDRLMRISDERFRDCICLNIYDRIDSMQMLGEFMMIKRAKSL |
| Ga0209742_102324092 | 3300027814 | Marine Sediment | CRSDYGHTGLEPLVVDGDIPMSILDERFRNCICLSNYNRIESMQMLGELVMIERAKSLERRIR |
| Ga0209635_101352524 | 3300027888 | Marine Sediment | MSILDERFRNCICLNIYDRICSMQMLGELIMIKMAKGLERRIS |
| Ga0209635_106390512 | 3300027888 | Marine Sediment | MDGERPMRIPDKRFRNCVCLDIQKRIDCMQMLGELIIIKRAKSLERRIR |
| Ga0209635_109065532 | 3300027888 | Marine Sediment | MGILDERFRKHICLNIYDRIESMQMLEELIMTRRAKSLERRIR |
| Ga0209636_105976463 | 3300027893 | Marine Sediment | MVGDKLMGISDERFRNCVCLNIYDRIDSMLMLGELIMINGANSLERRIR |
| Ga0209636_112740412 | 3300027893 | Marine Sediment | MVGGRLMGILDEHFRDCVCPNIYDRIDSMQVLGEIVMIKRAKSLERRIR |
| Ga0209253_102648062 | 3300027900 | Freshwater Lake Sediment | VVGDRLMRISDERFRDCICLNIYDRIDSMQMLGEFMMIKRAKSLERRIR |
| Ga0209427_107278552 | 3300027901 | Marine Sediment | MGISDERFRDFICLNIYDRIESMRVLGELIMIKRAKSLERRIR |
| Ga0209536_1000823283 | 3300027917 | Marine Sediment | MSILDERFRDCICLNIYDRIDSMRMLGELVMIKRAKSLERRIR |
| Ga0134606_100197103 | 3300029827 | Marine Sediment | VVGDKLMGILDERFRGCICLNIYDRIDSMRVLGELIMTNRAKSLERRIR |
| Ga0299915_104767712 | 3300030613 | Soil | MRILDERFRDCICLNIYDRIESMQMLGELIMIKRAKKLERRIR |
| Ga0307925_1067722 | 3300030714 | Soil | MRILDERFRDCICLNIYDRIDSMQMLGELVMIKRAKKLERRIR |
| Ga0307927_10273132 | 3300030717 | Soil | VVGDRLMRILDERFRDCICLNIYDRIDSMQMLGELVMIKRAKKLERRIR |
| Ga0315554_10575653 | 3300031255 | Salt Marsh Sediment | MVGDRLMGIIDERFRDCICLNIYDRIDSMQMLGELIMIKGAKSLERRIR |
| Ga0315555_12418981 | 3300031257 | Salt Marsh Sediment | VGDRLMGILDEHFRNCICLNIYDRIDSMQMLEELIMIKGAKSLERRIR |
| Ga0307439_10208912 | 3300031356 | Salt Marsh | MRILDKRFRDCICLNIYDRTDSMQMLGELIMIKGARSLERRIR |
| Ga0307438_10145722 | 3300031358 | Salt Marsh | MGGERLMRISDERFRNCVCLKVYNMIDSMRMLGELIMIKRTKSLERRIR |
| Ga0315544_10014429 | 3300031554 | Salt Marsh Sediment | VVGDRLMGILDEHFRNCICLNIYDRIDSMQMLEELIMIKGAKSLERRIR |
| Ga0315552_12300781 | 3300031620 | Salt Marsh Sediment | MVGDRLMGILDERFRNCICLNRYDRIDSMQMLEELIMIKGAKSLERRIR |
| Ga0315537_10295144 | 3300031698 | Salt Marsh Sediment | MVGDRLMGIIDERFRDCSCLNIYDRIDSMQMLGELIMIKGAKSLERRIR |
| Ga0315293_105946702 | 3300031746 | Sediment | MRISDERFRDCICLNIYDRIDSMQMLGEFMMIKRTKSLERRIR |
| Ga0315288_100338192 | 3300031772 | Sediment | MGILDERFRDCICLNIYDRIDSMQMLGEFMMIKRTKSLERRIR |
| Ga0315285_100080691 | 3300031885 | Sediment | EPRFVVGDRLMRISDERFRDCICLNIYDRIDSMQMLGEFMMINRAKSLERRIR |
| Ga0315294_100163083 | 3300031952 | Sediment | MRISDERFRDCICLNIYDRIDSMQMLGEFMMINRAKSLERRIR |
| Ga0315294_101285073 | 3300031952 | Sediment | VVGDRLMGILDERFRDCICLNIYDRIDSMQMLGEFMMIKRTKSLERRIR |
| Ga0315296_100099785 | 3300032020 | Sediment | MVGERLMRISDERFRNCVCLDIYDRIDSMRMLGELIIINRSKSLERRIR |
| Ga0315546_10038328 | 3300032029 | Salt Marsh Sediment | MRIQDKCFRNCICLNIYDRTDSMRMLGELIMIKGARSLERRIR |
| Ga0315289_102106592 | 3300032046 | Sediment | VVGDRLMRISDERFRDCICLNIYDRIDSMQMLGEFMMIKRTKSLERRIR |
| Ga0315289_105273722 | 3300032046 | Sediment | HIELEPRFVVGDRLMRISDERFRDCICLNIYDRIDSMQMLGEFMMINRAKSLERRIR |
| Ga0315292_114277382 | 3300032143 | Sediment | MRISDERFRDCICLNIYDRIDSMQMLGELMMIKRTKSLERRIR |
| Ga0315295_102756621 | 3300032156 | Sediment | MGILDERFRDCVCLNIYDRIDSMQMLGELIMINRAKS |
| Ga0315295_110966582 | 3300032156 | Sediment | VVGDRLMGILDERFRNCICLNIYDRIDSMQMLGKLIVINMAEGLERRIS |
| Ga0316593_100052394 | 3300032168 | Rhizosphere | MGILDERFRNCICLNIYDRIESMQMLGELIMIRRAKSLERRIR |
| Ga0316593_100070604 | 3300032168 | Rhizosphere | VAGDRLMSILDERFRDCICLNIYDRIDSMSMLEELVMIKRAKSLERRIR |
| Ga0316593_100181922 | 3300032168 | Rhizosphere | VVGDRLMSILDERFRDCICLNIYDRIDSMRMLGELIMIKRAKSLERRIR |
| Ga0316593_100194193 | 3300032168 | Rhizosphere | VAGDTVMSILDEHFRDCICLHIYDGINGMRMLGELVMIKRAKSLERRIR |
| Ga0316593_100288123 | 3300032168 | Rhizosphere | MRILDERFRNCICLNIYDRIDSMQMLGELIMIKGANSLERRIR |
| Ga0316593_100475682 | 3300032168 | Rhizosphere | VVRDRLMGILDECFRNCICLNMCDGIDSMRVLGELTMIKRAKSLERRIR |
| Ga0316593_100749193 | 3300032168 | Rhizosphere | MGILDEHFRNCICLNICDGISSMRMLGELVMIKRAKSLERRIR |
| Ga0316593_100935633 | 3300032168 | Rhizosphere | MSILDERFRNCICLNICDGIDSMRVLRELIMIKRAKSLERRIR |
| Ga0316593_101404812 | 3300032168 | Rhizosphere | MVGDGLMSIFDERFRDCICLNIYDRIDSMQMLGELIMKKGAKSLERRIR |
| Ga0316593_101900312 | 3300032168 | Rhizosphere | VSIFDERFRYCICLNIYDRIDSMQMLGELIMKKGAKSLERRIR |
| Ga0316593_103062911 | 3300032168 | Rhizosphere | VVGDRLMGILDERFRNCICLSIYDRIDGMQMLGELVMIKRAKSLER |
| Ga0316593_103201841 | 3300032168 | Rhizosphere | MRILDERFRNCICLNIYDRIDNMQMLGEVIMIKGANSLER |
| Ga0316593_103865911 | 3300032168 | Rhizosphere | MRILDKRFRDCICQNIYDRIGIQMRGELIMIKGANSLER |
| Ga0316593_104524522 | 3300032168 | Rhizosphere | RILDKRFRDCICRNIYDRIGIQMRGELIMIKGANSLERRIR |
| Ga0316622_1008122502 | 3300033416 | Soil | MVGDRLMGISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSFERRIR |
| Ga0316620_100165961 | 3300033480 | Soil | FRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0316620_101156781 | 3300033480 | Soil | MVGDRLMRISDERFRDCICLNIYDRIDSMQMLRELVMIKRAK |
| Ga0316628_1001043185 | 3300033513 | Soil | MVGDRLMRISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0316592_10442642 | 3300033524 | Rhizosphere | VDGDIPMSILDERFRNCICLNMYDRIESMQMLGELIMIKRAKSLERRIR |
| Ga0316592_10718362 | 3300033524 | Rhizosphere | LMGILDERFRDCICLSIYDRIESMQMLGELTMTKRAKSLERRIR |
| Ga0316588_10570282 | 3300033528 | Rhizosphere | VVGDRLMGILDEHFRNCICLSNYNRIESMQMLGELIMIERAKSLERRIR |
| Ga0316588_11320481 | 3300033528 | Rhizosphere | MRILDERFRNCICLNIYDRIDNMQMLGEVIMIKGANSLERRIR |
| Ga0316588_11420982 | 3300033528 | Rhizosphere | VVGDRLMGILDERFRNCICLNIYDRIDSMQMLGELTMIKRAKSLERRIR |
| Ga0316587_10199602 | 3300033529 | Rhizosphere | VVGDKLMGILDERFRDCICLNIYDRIDSMSMLEELVMIKRAKSLERRIR |
| Ga0316587_10558272 | 3300033529 | Rhizosphere | VVGDKLMGILDERFRGCICLNIYDRVDSMRVLGELIMTNRAKSLERRIR |
| Ga0316596_10149593 | 3300033541 | Rhizosphere | MVGDRLMGILDERFRDCICLNIYDRIESMQMLGELTMTKRAKSLERRIR |
| Ga0316596_11894011 | 3300033541 | Rhizosphere | MMGILDERFRNCICLSIYNRIESMQMLGELVMIKRAKSLERRI |
| Ga0334965_0275285_55_204 | 3300033991 | Sediment | MVGDRLMGILDERFRNCICLNIYDRIESMRVLGELVTIKRAKSLERRIR |
| Ga0373901_083391_420_566 | 3300034083 | Sediment Slurry | MVGERLMGILDERFRACICLNIYDRIDSMQMLELTTIKRAKSLERRIR |
| Ga0373913_0081424_6_137 | 3300034089 | Sediment Slurry | MGILDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0373913_0108542_10_141 | 3300034089 | Sediment Slurry | MGISDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSLERRIR |
| Ga0373909_0103133_596_745 | 3300034191 | Sediment Slurry | MVGDRLMGISDERFRDCICLNIYDRIDSMRMLGELVMIKRAKSLERRIR |
| ⦗Top⦘ |