


| Basic Information | |
|---|---|
| Family ID | F038735 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MKWFINSMLGYWILLLAISLGAAAVIYEIWLKGRV |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.44 % |
| % of genes near scaffold ends (potentially truncated) | 5.45 % |
| % of genes from short scaffolds (< 2000 bps) | 73.94 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.970 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (32.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF01925 | TauE | 40.00 |
| PF01326 | PPDK_N | 3.03 |
| PF00072 | Response_reg | 2.42 |
| PF07396 | Porin_O_P | 1.21 |
| PF00939 | Na_sulph_symp | 0.61 |
| PF13662 | Toprim_4 | 0.61 |
| PF01455 | HupF_HypC | 0.61 |
| PF05016 | ParE_toxin | 0.61 |
| PF02954 | HTH_8 | 0.61 |
| PF02769 | AIRS_C | 0.61 |
| PF10082 | BBP2_2 | 0.61 |
| PF02518 | HATPase_c | 0.61 |
| PF00512 | HisKA | 0.61 |
| PF01075 | Glyco_transf_9 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 40.00 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 3.03 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 1.21 |
| COG0298 | Hydrogenase maturation factor HybG, HypC/HupF family | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.61 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.97 % |
| Unclassified | root | N/A | 3.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000231|TB_LI09_4DRAFT_10107490 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10229339 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100224566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2637 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_102487805 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105137602 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105285483 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105468564 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106147778 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106188320 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106841574 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106942146 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108149998 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300002492|JGI24188J35168_1004569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 6462 | Open in IMG/M |
| 3300003432|JGI20214J51088_10170885 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300003859|Ga0031653_10060809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300004155|Ga0066600_10118101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300005839|Ga0068707_1005362 | All Organisms → cellular organisms → Bacteria | 8734 | Open in IMG/M |
| 3300006224|Ga0079037_100199685 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300006224|Ga0079037_100221036 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300006224|Ga0079037_100266824 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300006224|Ga0079037_100288770 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300006224|Ga0079037_100688527 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006930|Ga0079303_10243308 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006945|Ga0073933_1076089 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300007351|Ga0104751_1002875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 25535 | Open in IMG/M |
| 3300009009|Ga0105105_10025818 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
| 3300009037|Ga0105093_10503336 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009053|Ga0105095_10383640 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300009081|Ga0105098_10458020 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009082|Ga0105099_10360460 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300009085|Ga0105103_10287393 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300009091|Ga0102851_10586483 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300009091|Ga0102851_11025572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300009091|Ga0102851_11305481 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009091|Ga0102851_11863352 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300009091|Ga0102851_13009851 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009131|Ga0115027_10586069 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300009146|Ga0105091_10593700 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300009179|Ga0115028_10535794 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009179|Ga0115028_10777209 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009506|Ga0118657_10055967 | All Organisms → cellular organisms → Bacteria | 9000 | Open in IMG/M |
| 3300010284|Ga0129301_1004099 | All Organisms → cellular organisms → Bacteria | 5540 | Open in IMG/M |
| 3300010339|Ga0074046_10096711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1908 | Open in IMG/M |
| 3300010938|Ga0137716_10035297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5794 | Open in IMG/M |
| 3300011340|Ga0151652_11766931 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300011340|Ga0151652_13590815 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300011408|Ga0137460_1031715 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012204|Ga0137374_11038552 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012411|Ga0153880_1081274 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300013315|Ga0173609_10526868 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300014324|Ga0075352_1168577 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300014502|Ga0182021_12124757 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300014839|Ga0182027_10676804 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300017944|Ga0187786_10148598 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300017947|Ga0187785_10268108 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300017966|Ga0187776_10071601 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300017974|Ga0187777_10260113 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300017999|Ga0187767_10052553 | Not Available | 1014 | Open in IMG/M |
| 3300018064|Ga0187773_10990819 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018088|Ga0187771_10228481 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300019252|Ga0172286_1419184 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300020074|Ga0194113_10613217 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300021269|Ga0210356_106090 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300022548|Ga0212092_1014323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5416 | Open in IMG/M |
| 3300022554|Ga0212093_1001531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 63970 | Open in IMG/M |
| 3300022593|Ga0236338_1007294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2668 | Open in IMG/M |
| 3300022650|Ga0236339_1132605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2425 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10000140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 183332 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10004040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 25343 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10015274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 8015 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10023554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 5442 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10051769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2819 | Open in IMG/M |
| 3300024056|Ga0124853_1146030 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300024056|Ga0124853_1421771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2056 | Open in IMG/M |
| 3300025107|Ga0208863_1047362 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300025111|Ga0208968_1064359 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300025152|Ga0208373_1043757 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300027721|Ga0209492_1231611 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027740|Ga0214474_1213888 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300027792|Ga0209287_10120664 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300027811|Ga0256868_10072667 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300027841|Ga0209262_10130118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
| 3300027863|Ga0207433_10670811 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027871|Ga0209397_10043905 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300027885|Ga0209450_10011203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4837 | Open in IMG/M |
| 3300027887|Ga0208980_10058698 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300027887|Ga0208980_10115570 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300027887|Ga0208980_10126757 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300027887|Ga0208980_10178392 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300027887|Ga0208980_10407757 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300027887|Ga0208980_10492037 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300027896|Ga0209777_10199873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 1608 | Open in IMG/M |
| 3300027897|Ga0209254_10003680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 13983 | Open in IMG/M |
| 3300027897|Ga0209254_10335842 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300027897|Ga0209254_10828447 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027900|Ga0209253_10013352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7009 | Open in IMG/M |
| 3300027900|Ga0209253_10121942 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300027900|Ga0209253_10517356 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300027900|Ga0209253_11024775 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027902|Ga0209048_10074704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2674 | Open in IMG/M |
| 3300027902|Ga0209048_10118352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2015 | Open in IMG/M |
| 3300028032|Ga0265296_1004598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11909 | Open in IMG/M |
| 3300028032|Ga0265296_1150709 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300029327|Ga0243509_105438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 4155 | Open in IMG/M |
| 3300030613|Ga0299915_10833637 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300030613|Ga0299915_10868935 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031463|Ga0272448_1010357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 9392 | Open in IMG/M |
| 3300031564|Ga0318573_10410387 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031727|Ga0316576_11034935 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031834|Ga0315290_10029163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 4354 | Open in IMG/M |
| 3300031834|Ga0315290_10426441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1161 | Open in IMG/M |
| 3300031834|Ga0315290_11495355 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031873|Ga0315297_10042781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3396 | Open in IMG/M |
| 3300031873|Ga0315297_10045323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 3306 | Open in IMG/M |
| 3300031997|Ga0315278_10041966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4456 | Open in IMG/M |
| 3300031997|Ga0315278_10343021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300031997|Ga0315278_10810556 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300032156|Ga0315295_12004875 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032163|Ga0315281_10330391 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300032163|Ga0315281_10778800 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300032164|Ga0315283_11863043 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032173|Ga0315268_10001789 | All Organisms → cellular organisms → Bacteria | 24701 | Open in IMG/M |
| 3300032173|Ga0315268_10679478 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300032173|Ga0315268_10948283 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032173|Ga0315268_11093767 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300032173|Ga0315268_11102125 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032173|Ga0315268_11333964 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032173|Ga0315268_12135390 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032173|Ga0315268_12785745 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032342|Ga0315286_10302139 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300032342|Ga0315286_10343879 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300032342|Ga0315286_11000754 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300032342|Ga0315286_11552505 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032401|Ga0315275_10430558 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300032401|Ga0315275_12210488 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032516|Ga0315273_10503352 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300032516|Ga0315273_10543816 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300032516|Ga0315273_12166820 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032516|Ga0315273_13209756 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032893|Ga0335069_11855844 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300033406|Ga0316604_10134890 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300033406|Ga0316604_10554435 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300033408|Ga0316605_10737194 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300033408|Ga0316605_11734941 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300033416|Ga0316622_100185613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2203 | Open in IMG/M |
| 3300033416|Ga0316622_101259545 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300033416|Ga0316622_102000921 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300033416|Ga0316622_102643627 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300033416|Ga0316622_102676336 | Not Available | 573 | Open in IMG/M |
| 3300033419|Ga0316601_101924149 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300033482|Ga0316627_100974566 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300033482|Ga0316627_101027664 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300033483|Ga0316629_10394048 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300033485|Ga0316626_10004404 | All Organisms → cellular organisms → Bacteria | 7205 | Open in IMG/M |
| 3300033486|Ga0316624_10378992 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300033489|Ga0299912_10084470 | All Organisms → cellular organisms → Bacteria | 2782 | Open in IMG/M |
| 3300033489|Ga0299912_10574279 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300033489|Ga0299912_11277458 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300033513|Ga0316628_102959506 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300033521|Ga0316616_100123246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2368 | Open in IMG/M |
| 3300033521|Ga0316616_102645712 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300033557|Ga0316617_100180608 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 12.12% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 10.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 7.27% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.24% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.42% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.21% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 1.21% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 1.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.21% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 1.21% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.21% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.61% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.61% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.61% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 0.61% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 0.61% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.61% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.61% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.61% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.61% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.61% |
| Anode Biofilm | Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002492 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300005839 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006945 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC16 2012 metaG | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010284 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021269 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022548 | Cone Pool_combined assembly | Environmental | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025107 | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025111 | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025152 | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300029327 | Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilm | Engineered | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031463 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_101074902 | 3300000231 | Groundwater | MKALRWFVDSMLGYWILLLVICLGVAAGIYEIWLKGRI* |
| TB_LI09_4DRAFT_102293391 | 3300000231 | Groundwater | MKWFVNSMLGYWVLLLVISLGAAAIIYEIWLRGRI* |
| JGIcombinedJ13530_1002245665 | 3300001213 | Wetland | REEGKMAKGMRWFIDSMLGYWILLLVISLGAATVIYEVWLKGRV* |
| JGIcombinedJ13530_1013178323 | 3300001213 | Wetland | WFIDSMIGYWVLLLIISLGGAAIIYLMYLRDHLF* |
| JGIcombinedJ13530_1024878052 | 3300001213 | Wetland | MKWFINSMLGYWILLLAISLGAAAVIYEIWLKGRV* |
| JGIcombinedJ13530_1051376023 | 3300001213 | Wetland | MKWFINSMFGYWILLLAIALGIASWIYFAWLKDALI* |
| JGIcombinedJ13530_1052854832 | 3300001213 | Wetland | MRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGSMHM* |
| JGIcombinedJ13530_1054685643 | 3300001213 | Wetland | MRWLYHTMIGYWILLLSISLGAAAIIYEVWLRGNI* |
| JGIcombinedJ13530_1061477782 | 3300001213 | Wetland | MKWFVNTMLGYWILLLAISLSAAAVVYEIWFKGRI* |
| JGIcombinedJ13530_1061883204 | 3300001213 | Wetland | MAKGLRWFWDSMLGYWVLLLTISLGAAAVVYELWLKGRV* |
| JGIcombinedJ13530_1068415741 | 3300001213 | Wetland | MAKGLRWFIDSMLGYWILLLAISLGAAAVIYELWLKGRV* |
| JGIcombinedJ13530_1069421462 | 3300001213 | Wetland | MAVPRAFRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM* |
| JGIcombinedJ13530_1081499981 | 3300001213 | Wetland | MKWFIDSMFGYWILLLAFSLGVSALIYEVWLRGNL* |
| JGI24188J35168_10045695 | 3300002492 | Anoxygenic And Chlorotrophic Microbial Mat | MEEESKAMRWFIDSMLGYWXLLLAISMGTAAAVYLLWLKQAAFSG* |
| JGI20214J51088_101708853 | 3300003432 | Wetland | MAKGLRWFIDSMLGYWILLLAISLGAAAGIYELWLKGRV* |
| Ga0031653_100608092 | 3300003859 | Freshwater Lake Sediment | MTGFVHKLRWFVDSMLGYWVLLLIISLGSAAVIYEIWLKGRM* |
| Ga0066600_101181013 | 3300004155 | Freshwater | MPKKLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM* |
| Ga0068707_10053625 | 3300005839 | Anoxygenic And Chlorotrophic | MRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG* |
| Ga0079037_1001996852 | 3300006224 | Freshwater Wetlands | MKWFINSMLGFWILLLTISLGAAAVVYEIWLKGHV* |
| Ga0079037_1002210363 | 3300006224 | Freshwater Wetlands | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV* |
| Ga0079037_1002668243 | 3300006224 | Freshwater Wetlands | MKWFINSMLGFWVLLLAISLGAAAIVYEIWLKGRV* |
| Ga0079037_1002887702 | 3300006224 | Freshwater Wetlands | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGRI* |
| Ga0079037_1006885272 | 3300006224 | Freshwater Wetlands | MTGFVHKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM* |
| Ga0079303_102433083 | 3300006930 | Deep Subsurface | MPKKLRWFIDSMFGYWVLLLVISLGTAAGIYEIWLKGRM* |
| Ga0073933_10760893 | 3300006945 | Hot Spring Sediment | MEEESKAMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG* |
| Ga0104751_100287514 | 3300007351 | Deep Subsurface Aquifer | MKWFINSMIGYWVLLLAISLGIAAVIYEVWLRDALLK* |
| Ga0105105_100258184 | 3300009009 | Freshwater Sediment | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGHV* |
| Ga0105093_105033362 | 3300009037 | Freshwater Sediment | MKWFINSMLGFCVLLLAISLGAAAIVYEIWLKGRV* |
| Ga0105095_103836403 | 3300009053 | Freshwater Sediment | MKWFINSMLGFWILLLTISLGAAAIVYEIWLKGHV* |
| Ga0105098_104580202 | 3300009081 | Freshwater Sediment | MKWFINSMLGFWILLLAISLGAAAVVYEIWLKGHV* |
| Ga0105099_103604602 | 3300009082 | Freshwater Sediment | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGRV* |
| Ga0105103_102873931 | 3300009085 | Freshwater Sediment | MKWFINSMLGFWILLLAISLGAAALVYEIWLKGRV* |
| Ga0102851_105864832 | 3300009091 | Freshwater Wetlands | MKWFINSMLGYWILLLAISLGAAALIYEIWLKGRV* |
| Ga0102851_110255723 | 3300009091 | Freshwater Wetlands | WSMAAPKALRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM* |
| Ga0102851_113054812 | 3300009091 | Freshwater Wetlands | MKWFINSMLGFWILLLAISLGAAALVYEIWLKGHV* |
| Ga0102851_118633522 | 3300009091 | Freshwater Wetlands | MKWFINSMLGFWILLLVISLGAAALVYEIWLKGHV* |
| Ga0102851_130098512 | 3300009091 | Freshwater Wetlands | VKFLINTMWGFWLLLLAISLGAAAIVYELWLKGNV* |
| Ga0115027_105860691 | 3300009131 | Wetland | MAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM* |
| Ga0105091_105937002 | 3300009146 | Freshwater Sediment | MKWFINSMLGYWILLLAISLGAAAVVYEIWLKGRI* |
| Ga0115028_105357942 | 3300009179 | Wetland | MAKGLRWFWDSMLGYWVLLLAISLGAAAVVYELWLKGRV* |
| Ga0115028_107772091 | 3300009179 | Wetland | MKWFINSMLGFWILLLSISLGAAALVYEIWLKGRI* |
| Ga0118657_100559678 | 3300009506 | Mangrove Sediment | MPKALRWFVDSMLGYWVLLLTISLFSAAGIYEVWLKGRL* |
| Ga0129301_10040994 | 3300010284 | Hot Spring Microbial Mat | MKWLINRLLAFWLLLLAISLGAAALVYEIWLKGRI* |
| Ga0074046_100967113 | 3300010339 | Bog Forest Soil | MKWFINSMLGYWILLLAFSLGVSAVIYVLWLKDALL* |
| Ga0137716_100352972 | 3300010938 | Hot Spring Fe-Si Sediment | MKWFIDSMLGYWIMLLAASLGAAACIYVFWLKDALY* |
| Ga0151652_117669313 | 3300011340 | Wetland | MKWFINSMLGYWVLLLAISLGAAAIVYEIWLKGRF* |
| Ga0151652_135908152 | 3300011340 | Wetland | MKWFINSMLGYWVLLLAISLGAAALVYEIWLKGRV* |
| Ga0137460_10317152 | 3300011408 | Soil | MKWFINSMLGYWILLLAISLGAAAVVYEIWLKGHV* |
| Ga0137374_110385522 | 3300012204 | Vadose Zone Soil | MKWFINTMPGYWILLLAISMSAAAGIYELWLKNQM* |
| Ga0153880_10812743 | 3300012411 | Freshwater Sediment | MKWFINSMIGYWILLLTISLGIAAAIYEFWLKGTV* |
| Ga0173609_105268682 | 3300013315 | Sediment | MPKGIRWFWDSMLGYWVLLLTISLGAAAVVYELWLKGRV* |
| Ga0075352_11685772 | 3300014324 | Natural And Restored Wetlands | MKWFINSMFGFWVLLLVISLGAAAIVYEIWLKGHV* |
| Ga0182021_121247572 | 3300014502 | Fen | MKWFINSMLGYWILLLTISCTIALVIYEVWLKGTV* |
| Ga0182027_106768043 | 3300014839 | Fen | MTFMKWFINSMLGYWILLLTISCTIALVIYEVWLKGVV* |
| Ga0187786_101485982 | 3300017944 | Tropical Peatland | MKWFINSMLGFWVLLLAISLGAAAIVYEIWLKGRV |
| Ga0187785_102681082 | 3300017947 | Tropical Peatland | MRWFIDSMIGYWVLLLAISLGVSAVIYEVWLKGNI |
| Ga0187776_100716012 | 3300017966 | Tropical Peatland | MGRLRWFVDSMVGYWILVLAVSLAIAAGIYEIWLKGKM |
| Ga0187777_102601132 | 3300017974 | Tropical Peatland | MRWFIDSMIGYWILLLAISLGAAAVVYEVWLRGNI |
| Ga0187767_100525532 | 3300017999 | Tropical Peatland | MQRLRWFVDSMLGYWILLLAVSMGIAAGIYEMWLKGRM |
| Ga0187773_109908193 | 3300018064 | Tropical Peatland | MKWFIDSMVGWWVLLLVVSWCAAAVVYELWLRGNIV |
| Ga0187771_102284813 | 3300018088 | Tropical Peatland | MGRLRWFVDSMVGYLILLWAVSLGIAAGIYEMWLKGKM |
| Ga0172286_14191842 | 3300019252 | Wetland | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGHV |
| Ga0194113_106132172 | 3300020074 | Freshwater Lake | MKWFVNTMLGYWILLLVISMGVAAAIYEIWLKGSV |
| Ga0210356_1060902 | 3300021269 | Estuarine | MKWFINSMIGYWIFLLAISLGLAAICYEVFLKQMMR |
| Ga0212092_10143234 | 3300022548 | Hot Spring Microbial Mat | MKWLINRLLGFWLLLLAISLGAAALVYEIWLKGRI |
| Ga0212093_100153118 | 3300022554 | Hot Spring Sediment | MRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG |
| Ga0236338_10072943 | 3300022593 | Freshwater | MKWFINSMLGYWILLLAFSLGVSAVIYVIWLKDALL |
| Ga0236339_11326053 | 3300022650 | Freshwater | MKWFINSMLGYWILLLAFSLGVSAVIYVLWLKDALL |
| Ga0255811_112759313 | 3300023207 | Anaerobic Digester Digestate | VLKEANIMNWFWDTMIGYWVLLLAISLGAAAVIYVLYLKDTLF |
| (restricted) Ga0233425_1000014064 | 3300024054 | Freshwater | MKWFINSMIGYWILLLAISLGAAAVVYEVWLRGNI |
| (restricted) Ga0233425_1000404017 | 3300024054 | Freshwater | MKWFINSMIGYWVLLLAISLGAAAVVYEVWLRGNI |
| (restricted) Ga0233425_100152744 | 3300024054 | Freshwater | MRWFIDSMLGYWILVLAVSLGTAAVIYQIWLKDSL |
| (restricted) Ga0233425_100235542 | 3300024054 | Freshwater | MRWFYDSMSGYWILLLLISLGGAAVIYMVWLQDTLF |
| (restricted) Ga0233425_100517694 | 3300024054 | Freshwater | MRWFIDSMLGFWVLLLTISLAIAWGIYEIWLRGSV |
| Ga0124853_11460301 | 3300024056 | Freshwater Wetlands | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGRI |
| Ga0124853_14217711 | 3300024056 | Freshwater Wetlands | MKWFINSMLGFWILLLTISLGAAAVVYEIWLKGHV |
| Ga0208863_10473622 | 3300025107 | Soil | MKRILNSMLGFWLLLLGISLGTAGIIYEVWLKGRI |
| Ga0208968_10643593 | 3300025111 | Soil | MPKVLHWFVNSMLGYWILLLVFSMGIAASIYEVWLKDRM |
| Ga0208373_10437571 | 3300025152 | Soil | MKWFVNSMLGYWILLLTISMGAAGIIYEIWLKGKV |
| Ga0209492_12316112 | 3300027721 | Freshwater Sediment | MKWFINSMLGFWILLLAISLGAAAVVYEIWLKGHV |
| Ga0214474_12138882 | 3300027740 | Soil | MKWFINSMLGFWVLLLVISLGAAALVYEIWLKGRI |
| Ga0209287_101206643 | 3300027792 | Freshwater Sediment | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGRV |
| Ga0256868_100726674 | 3300027811 | Soil | MKWFINSLMGYWILLLAISLGAAALVYQIWLKGRI |
| Ga0209262_101301184 | 3300027841 | Freshwater | MPKKLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM |
| Ga0207433_106708113 | 3300027863 | Hot Spring | MEEESKAMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG |
| Ga0209397_100439052 | 3300027871 | Wetland | MKWFINSMLGFWILLLAISLGAAALVYEIWLKGHV |
| Ga0209450_100112034 | 3300027885 | Freshwater Lake Sediment | MAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM |
| Ga0208980_100586983 | 3300027887 | Wetland | MKWFINSMLGFWILLLVISLGAAAVVYEIWLKGHV |
| Ga0208980_101155703 | 3300027887 | Wetland | MKWFINSMFGFWVLLLVISLGAAAIVYEIWLKGHV |
| Ga0208980_101267572 | 3300027887 | Wetland | MAKRLRWFIDSMFGYWVLLLIISLGTAAGIYEVWLKGRM |
| Ga0208980_101783922 | 3300027887 | Wetland | MKWFINSMLGFWILLLVISLGAAAIVYEVWLKGHV |
| Ga0208980_104077573 | 3300027887 | Wetland | MKWFVNTMLGYWILLLVISLGAAAVVYEIWLKGRI |
| Ga0208980_104920372 | 3300027887 | Wetland | MKWFVNTMLGYWILLLAISLSAAAVVYEIWFKGRI |
| Ga0209777_101998734 | 3300027896 | Freshwater Lake Sediment | MRWLINSMLGYWVLLLVISLGAAGVIYEVWLKGNM |
| Ga0209254_1000368011 | 3300027897 | Freshwater Lake Sediment | MKWFINSMLGFWILLLAISLGAAALVYEIWLKGRV |
| Ga0209254_103358422 | 3300027897 | Freshwater Lake Sediment | MPKGLRWFVDSMLGYWVLLLVISLGAAAGIYEVWLKGRM |
| Ga0209254_108284472 | 3300027897 | Freshwater Lake Sediment | MKWFINSMVGYWILLLAISLGIAAVIYAVWLRDALL |
| Ga0209253_100133527 | 3300027900 | Freshwater Lake Sediment | MKWFINSMLGFWILLLAISLGAAALVCEIWLKGRV |
| Ga0209253_101219422 | 3300027900 | Freshwater Lake Sediment | MKWFLNSMLGYWVLLLAISLGAAAIIYEIWLKGRM |
| Ga0209253_105173562 | 3300027900 | Freshwater Lake Sediment | MTGFVHKLRWFVDSMLGYWVLLLIISLGSAAVIYEIWLKGRM |
| Ga0209253_110247751 | 3300027900 | Freshwater Lake Sediment | MTGFVHKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM |
| Ga0209048_100747043 | 3300027902 | Freshwater Lake Sediment | MRWFIDSMVGYWILLLLISLGVAAIIYLVYLKDAMNF |
| Ga0209048_101183523 | 3300027902 | Freshwater Lake Sediment | MRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGTMHM |
| Ga0265296_100026352 | 3300028032 | Groundwater | MKWFINTMIGYWVLLLAISLGIAAAIYEIWLRDALF |
| Ga0265296_100459812 | 3300028032 | Groundwater | MRWFIDSMIGYWVLLLAISLGIAAVIYEVWLRGSLVY |
| Ga0265296_11507092 | 3300028032 | Groundwater | MKWFIDSMIGYWVLLLTISLGIAAVIYEVWLRDTLLK |
| Ga0243509_1054385 | 3300029327 | Anode Biofilm | MKVFIDSMLGYWILLLAISLGVAAMIYQLWLRNVL |
| Ga0299915_108336373 | 3300030613 | Soil | MKWLLNSMLGYWILLLVFSLGAAAVIYEVWLKGHL |
| Ga0299915_108689351 | 3300030613 | Soil | MIGSVHKLRWFVDSMVGYWVLLLVISLGSAAVIYEIWLKGRM |
| Ga0272448_10103575 | 3300031463 | Sediment | MKWFIDSMLGYWIMLLAASLGAAACIYVFWLKDALY |
| Ga0318573_104103873 | 3300031564 | Soil | MKWFIDSMLGYWILLLAVSMGAAAGIYEMWLKNAM |
| Ga0316576_110349352 | 3300031727 | Rhizosphere | VPKALRWFVDSMLGYWVLLLTISLFSAAGIYEVWLKGRL |
| Ga0315290_100291634 | 3300031834 | Sediment | MRWFIHSMVGYWVLLLAISLGVAAAIYEIWLRGNI |
| Ga0315290_104264413 | 3300031834 | Sediment | MKWFIESMFGYWILLLAIALGLAAGVYLVWLKDALV |
| Ga0315290_114953552 | 3300031834 | Sediment | MKWFVNSMLGFWVLLLAISLGAAAVVYEIWLKGRV |
| Ga0315297_100427814 | 3300031873 | Sediment | MKWFLNSMLGYWVLLLAISLGAAAIIYEIWLKGRV |
| Ga0315297_100453235 | 3300031873 | Sediment | MRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGSMHM |
| Ga0315278_100419664 | 3300031997 | Sediment | MAKGLRWFIDSMLGYWILLLVISLGGAAAIYELWLKGRV |
| Ga0315278_103430214 | 3300031997 | Sediment | MKWFVTSMFGYWILLLVISLGSAAAIYEIWLRGNM |
| Ga0315278_108105563 | 3300031997 | Sediment | MKWFINSMLGFWILLLAISLGAAAVVYEIWLKGNV |
| Ga0315295_120048751 | 3300032156 | Sediment | MKWFIESMLGYWILLLAISLGLAAGIYVIWLKDALY |
| Ga0315281_103303911 | 3300032163 | Sediment | MKWFINSMLGYWILLLAFSLGAAAVVYEIWLKGHV |
| Ga0315281_107788003 | 3300032163 | Sediment | MKWFINSMLGYWILLLAISLGAAAIVYEIWLKGHV |
| Ga0315283_118630432 | 3300032164 | Sediment | MKWIMNTMLGYWILLLVISMGAAALVYEIWLKGRM |
| Ga0315268_1000178914 | 3300032173 | Sediment | MKWFVNSMLGYWILLLIISLGSATVIYEIWLKNRM |
| Ga0315268_106794782 | 3300032173 | Sediment | MAKGLRWFVDSMLGYWILLLTISLAVAAVIYELWLKGRM |
| Ga0315268_109482831 | 3300032173 | Sediment | MKWFINSMLGYWTLLLAISLGAAAGIYVVWLKGRM |
| Ga0315268_110937671 | 3300032173 | Sediment | MKWFINSMIGWWLLLLAISLGISAVAYELFLKQMMR |
| Ga0315268_111021252 | 3300032173 | Sediment | MKWFVDSMLGYWILLLAVSLCAAALIYEIWLKGTLV |
| Ga0315268_113339642 | 3300032173 | Sediment | MRWFIDSMIGYWILLLTFSLGVAAVIYEVWLRGNL |
| Ga0315268_121353902 | 3300032173 | Sediment | MKWFINTMLGYWILLLVISLGAAALIYSIWLKGVI |
| Ga0315268_127857451 | 3300032173 | Sediment | ARHVRRSKMSKRLSWFIDSMLGYWVLLLTISLGAAAGIYEIWLKGRM |
| Ga0315286_103021392 | 3300032342 | Sediment | MKWFINSMLGFWILLLAISLGAAAIVYEIWLKGHV |
| Ga0315286_103438792 | 3300032342 | Sediment | MKWFINSMLGYWCLLLAISLGAAAWVYLTWLKDVM |
| Ga0315286_110007542 | 3300032342 | Sediment | MKWFVNSMFGYWILLLIISLGSAAAIYEIWLRGSM |
| Ga0315286_115525052 | 3300032342 | Sediment | MKWFVNTMLGYWILLLVISLGAAAVIYEIWLKGRI |
| Ga0315275_104305583 | 3300032401 | Sediment | MKWFVESMLGYWILLLAISLGLAAGIYVVWLKDALY |
| Ga0315275_122104881 | 3300032401 | Sediment | MKWFINSMLGYWILLLAISLGAAAIVYEIWLKGNV |
| Ga0315273_105033523 | 3300032516 | Sediment | MKKLINSMLGYWILLLVISLGAAAVIYEIWLRGNI |
| Ga0315273_105438162 | 3300032516 | Sediment | MRWFIDSMIGYWILLLTASLGVAAVIYEVWLRGSMHM |
| Ga0315273_121668202 | 3300032516 | Sediment | MKWFVNSMFGYWILLLIVSLGSAAAIYEIWLRGSM |
| Ga0315273_132097562 | 3300032516 | Sediment | MKWFINSMLGYWILLLTFSLGSAAVIYEVWLKGRM |
| Ga0335069_118558441 | 3300032893 | Soil | MRWFIDSMIGYWILVLVFSLAVAAVIYEFWLKGNVF |
| Ga0316604_101348903 | 3300033406 | Soil | MKWFINSMLGFWILLLSISLGAAALVYEIWLKGRI |
| Ga0316604_105544352 | 3300033406 | Soil | MPKKLRWFIDSMFGYWVLLLVISLGTAAGIYEIWLKGRM |
| Ga0316605_107371942 | 3300033408 | Soil | MKWFINSMLGFWILLLAISLGAAALVYEIWLKGRI |
| Ga0316605_117349412 | 3300033408 | Soil | MKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV |
| Ga0316622_1001856133 | 3300033416 | Soil | MKWFYESMVGYWIMLLAISLGAAAAIYLLWLREALY |
| Ga0316622_1012595451 | 3300033416 | Soil | MAVPRAFRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM |
| Ga0316622_1020009211 | 3300033416 | Soil | MKWFVNSMLGYWILLLAISMGAAAGIYEIWLKGKV |
| Ga0316622_1026436271 | 3300033416 | Soil | MRWFIDSMFGYWILLLAIALGTAAGIYLVWLRDAIF |
| Ga0316622_1026763361 | 3300033416 | Soil | MDKKWYDSMLTYWIVLLVISLGAAGAAYVIWLKEAM |
| Ga0316601_1019241492 | 3300033419 | Soil | MAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEIWLKGRM |
| Ga0316627_1009745662 | 3300033482 | Soil | MKWFVNSMLGFWILLLAISLGAAALVYEIWLKGRI |
| Ga0316627_1010276642 | 3300033482 | Soil | MRWFVNSMLGYWVLLLAISMGTAAAIYEMWLKDRM |
| Ga0316629_103940483 | 3300033483 | Soil | EKTSMKWFINSMLGFWILLLAISLGAAAIVYEIWLKGHV |
| Ga0316626_100044042 | 3300033485 | Soil | MTGFVNKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM |
| Ga0316624_103789923 | 3300033486 | Soil | MKWFINSMLGYWVLLLVISLGAAAIIYEVWLKGRV |
| Ga0299912_100844702 | 3300033489 | Soil | VTTPKAVRWFTESMFGYWVLLLAISLALAAGIYEVWLKGRM |
| Ga0299912_105742792 | 3300033489 | Soil | MKWFVNSMLGYWVLLLAISLGAAAIIYEIWLKGRM |
| Ga0299912_112774582 | 3300033489 | Soil | MPKALRWFVESMFGYWVLLLTVSLGVAAVIYEMWLKGKI |
| Ga0316628_1029595061 | 3300033513 | Soil | MKWFINSMLGYWILLLAISLGSAAIIYEVWLKGTI |
| Ga0316616_1001232461 | 3300033521 | Soil | KEETSMKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV |
| Ga0316616_1026457122 | 3300033521 | Soil | MKWLVSSMLGYAILLLAVSMAMALGIYELWLKNRM |
| Ga0316617_1001806083 | 3300033557 | Soil | MKWFINSMLGFWILLLVISLGAAALVYEIWLKGHV |
| ⦗Top⦘ |