| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025107 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0055717 | Ga0208863 |
| Sample Name | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D3 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 339959766 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| F038735 | Metagenome / Metatranscriptome | 165 | Y |
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| F096552 | Metagenome / Metatranscriptome | 104 | Y |
| F105436 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208863_1002558 | All Organisms → cellular organisms → Bacteria | 9289 | Open in IMG/M |
| Ga0208863_1020900 | Not Available | 2021 | Open in IMG/M |
| Ga0208863_1047362 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| Ga0208863_1074079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 926 | Open in IMG/M |
| Ga0208863_1149443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 570 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208863_1002558 | Ga0208863_10025581 | F105436 | MKLVFVNVMQELRRFDSTAYITQPPVPLAILNGATPKEIETALLDEQADRLRFEGDAFAFSVSTQNARAVYEHADALRASGGDARERPCATLFPGGL |
| Ga0208863_1020900 | Ga0208863_10209002 | F050966 | MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHPLTLPAD |
| Ga0208863_1047362 | Ga0208863_10473622 | F038735 | MKRILNSMLGFWLLLLGISLGTAGIIYEVWLKGRI |
| Ga0208863_1074079 | Ga0208863_10740793 | F002525 | VTCVWAGVDSVWEQEKLEARKMLVNRADSHTSVARFVGWRFSF |
| Ga0208863_1149443 | Ga0208863_11494431 | F096552 | MKMKNVFAVTSTSLVLLLLAACNAIKPTPAPTQTPQVLPASGEQYYFVTNKLLLPTTQAQTEAYALNVDGDSQQRPDNKFGDLFTLLASAAQGIELQASLDQAVNTGQLVSLHVVKADGLLNDPSVLWSIFAGQKSQSAPRFDGSDNLTVDTAAPAYSPLVGLLTNGRFT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |