


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003408 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095076 | Ga0041897 |
| Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 284901232 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Africa: Cape Town | |||||||
| Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006009 | Metagenome / Metatranscriptome | 384 | Y |
| F021521 | Metagenome / Metatranscriptome | 218 | Y |
| F025775 | Metagenome | 200 | Y |
| F064866 | Metagenome / Metatranscriptome | 128 | Y |
| F065495 | Metagenome / Metatranscriptome | 127 | Y |
| F069722 | Metagenome / Metatranscriptome | 123 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI26524J50256_1000001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 652222 | Open in IMG/M |
| JGI26524J50256_1000146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 119024 | Open in IMG/M |
| JGI26524J50256_1002483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 10878 | Open in IMG/M |
| JGI26524J50256_1003382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 7692 | Open in IMG/M |
| JGI26524J50256_1025892 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| JGI26524J50256_1059722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 830 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI26524J50256_1000001 | JGI26524J50256_100000180 | F064866 | MKAPYLCWLVSISALLYPYISSAQWDENNSLGRYSYPIFAVTGKQQFTGTAFFYRSGDTTFLVSNYHAIKGMSPLKKTITFNSDTLYLKYSVKDSGGSKVLPIDVSDAAIGETEIFSMVDRIDLLKIPMELPGDADIHFINDLVDPAYFNAVPEEVVVFGFPTGPGNIPPFYSQQQILAGQVNQQGFADYDASLKVNFPGSSDSARAILSGTARYYYFIKPYAAQGYSGAPVFGKFRTAEGQVIYRFSGVIFAGQPMTRQTWAIKGSVALQYLKGEL* |
| JGI26524J50256_1000146 | JGI26524J50256_100014647 | F021521 | MAGYSHRTATTIYLAAFRPWGGSTGAGRVRPAGAKIQAQGIFPQKKAL* |
| JGI26524J50256_1002483 | JGI26524J50256_100248314 | F069722 | MRVRLSAELDPKAKRERPALKKGAAHEKALGHGSGAALQE* |
| JGI26524J50256_1003382 | JGI26524J50256_10033821 | F025775 | NFNGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
| JGI26524J50256_1025892 | JGI26524J50256_10258922 | F006009 | MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG* |
| JGI26524J50256_1059722 | JGI26524J50256_10597222 | F065495 | MLHRLTVGHLDVAAVERRQTVPVKALEMDVVHRLLGELGEKDDDGDVTLGGCKVKFENGAVSCLWMGGRANRVAEEFALRMHRETGCVIADVGGYRVIEPDELTGLTGQASGSKPGAVRTR* |
| ⦗Top⦘ |