


| Basic Information | |
|---|---|
| Family ID | F069722 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.91 % |
| % of genes near scaffold ends (potentially truncated) | 43.90 % |
| % of genes from short scaffolds (< 2000 bps) | 82.11 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.683 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (47.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.309 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.805 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 0.00% Coil/Unstructured: 89.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF13495 | Phage_int_SAM_4 | 4.96 |
| PF07883 | Cupin_2 | 4.13 |
| PF13248 | zf-ribbon_3 | 1.65 |
| PF05598 | DUF772 | 1.65 |
| PF06231 | DUF1010 | 1.65 |
| PF14491 | DUF4435 | 0.83 |
| PF04471 | Mrr_cat | 0.83 |
| PF14833 | NAD_binding_11 | 0.83 |
| PF10987 | DUF2806 | 0.83 |
| PF14237 | GYF_2 | 0.83 |
| PF07799 | DUF1643 | 0.83 |
| PF12686 | DUF3800 | 0.83 |
| PF05163 | DinB | 0.83 |
| PF08327 | AHSA1 | 0.83 |
| PF13006 | Nterm_IS4 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF00144 | Beta-lactamase | 0.83 |
| PF06305 | LapA_dom | 0.83 |
| PF13673 | Acetyltransf_10 | 0.83 |
| PF13427 | DUF4111 | 0.83 |
| PF00893 | Multi_Drug_Res | 0.83 |
| PF13424 | TPR_12 | 0.83 |
| PF02963 | EcoRI | 0.83 |
| PF09851 | SHOCT | 0.83 |
| PF08937 | DUF1863 | 0.83 |
| PF09406 | DUF2004 | 0.83 |
| PF13240 | zinc_ribbon_2 | 0.83 |
| PF08768 | THAP4_heme-bd | 0.83 |
| PF07366 | SnoaL | 0.83 |
| PF00849 | PseudoU_synth_2 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.83 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.83 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.83 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG4333 | Uncharacterized conserved protein, DUF1643 domain | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.68 % |
| Unclassified | root | N/A | 7.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2013843001|PLMO_FPCF17101_b1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 836 | Open in IMG/M |
| 3300000052|Draft_c061527 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
| 3300001096|JGI11944J13513_1054006 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300001592|Draft_10028506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3936 | Open in IMG/M |
| 3300001592|Draft_10352203 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300002098|JGI24219J26650_1005720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2486 | Open in IMG/M |
| 3300002223|C687J26845_10001412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 14893 | Open in IMG/M |
| 3300002596|draft_1353451 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300003408|JGI26524J50256_1002483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 10878 | Open in IMG/M |
| 3300003764|Ga0056910_1006079 | Not Available | 2298 | Open in IMG/M |
| 3300003764|Ga0056910_1006079 | Not Available | 2298 | Open in IMG/M |
| 3300003764|Ga0056910_1007557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1894 | Open in IMG/M |
| 3300003764|Ga0056910_1023945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae | 786 | Open in IMG/M |
| 3300003767|Ga0056908_1004510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3220 | Open in IMG/M |
| 3300003767|Ga0056908_1004872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3013 | Open in IMG/M |
| 3300003844|Ga0056914_10024895 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300004463|Ga0063356_102124640 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300004463|Ga0063356_103893894 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300004463|Ga0063356_104907167 | Not Available | 575 | Open in IMG/M |
| 3300004463|Ga0063356_104979933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 571 | Open in IMG/M |
| 3300005076|Ga0069612_10123421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 839 | Open in IMG/M |
| 3300005080|Ga0069611_10081870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
| 3300005659|Ga0073900_10016526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3445 | Open in IMG/M |
| 3300005660|Ga0073904_10091293 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300005660|Ga0073904_10266950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 980 | Open in IMG/M |
| 3300005660|Ga0073904_10609988 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005819|Ga0078536_101215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 4377 | Open in IMG/M |
| 3300005982|Ga0075156_10119185 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300005982|Ga0075156_10249564 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005982|Ga0075156_10303623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5 | 833 | Open in IMG/M |
| 3300005989|Ga0075154_10562204 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006092|Ga0082021_1094334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1400 | Open in IMG/M |
| 3300007281|Ga0104349_1058353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300007790|Ga0105679_10281739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300008070|Ga0110938_1006692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300008071|Ga0110933_1089100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1005 | Open in IMG/M |
| 3300009070|Ga0066256_1045756 | Not Available | 1338 | Open in IMG/M |
| 3300009196|Ga0103745_10023708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa | 837 | Open in IMG/M |
| 3300009351|Ga0115924_1065342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1107 | Open in IMG/M |
| 3300009501|Ga0124838_10008560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2581 | Open in IMG/M |
| 3300009501|Ga0124838_10116671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1336 | Open in IMG/M |
| 3300009501|Ga0124838_10127396 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300009648|Ga0116175_1018789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2891 | Open in IMG/M |
| 3300009648|Ga0116175_1091514 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300009648|Ga0116175_1214667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 637 | Open in IMG/M |
| 3300009653|Ga0116169_1082273 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300009653|Ga0116169_1099967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300009653|Ga0116169_1206840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300009653|Ga0116169_1231533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300009653|Ga0116169_1314880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 510 | Open in IMG/M |
| 3300009653|Ga0116169_1316307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300009654|Ga0116167_1076881 | Not Available | 1282 | Open in IMG/M |
| 3300009654|Ga0116167_1106994 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300009657|Ga0116179_1199220 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009657|Ga0116179_1232572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300009658|Ga0116188_1260060 | Not Available | 604 | Open in IMG/M |
| 3300009663|Ga0116181_1050402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1881 | Open in IMG/M |
| 3300009663|Ga0116181_1138953 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11 | 944 | Open in IMG/M |
| 3300009663|Ga0116181_1159025 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009664|Ga0116146_1396284 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009668|Ga0116180_1071356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300009668|Ga0116180_1113079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 1143 | Open in IMG/M |
| 3300009668|Ga0116180_1120901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 1091 | Open in IMG/M |
| 3300009670|Ga0116183_1189405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300009685|Ga0116142_10017269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4991 | Open in IMG/M |
| 3300009689|Ga0116186_1292526 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009704|Ga0116145_1261599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300009704|Ga0116145_1261599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300009711|Ga0116166_1032561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2506 | Open in IMG/M |
| 3300009712|Ga0116165_1062446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1484 | Open in IMG/M |
| 3300009712|Ga0116165_1187278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 705 | Open in IMG/M |
| 3300009714|Ga0116189_1288975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 561 | Open in IMG/M |
| 3300009761|Ga0116168_1120552 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300009769|Ga0116184_10441688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300009776|Ga0116154_10407130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Candidatus Viridilinea → Candidatus Viridilinea halotolerans | 580 | Open in IMG/M |
| 3300009782|Ga0116157_10651622 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009870|Ga0131092_10061673 | All Organisms → cellular organisms → Bacteria | 4852 | Open in IMG/M |
| 3300009870|Ga0131092_10164153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2406 | Open in IMG/M |
| 3300009870|Ga0131092_10237067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1852 | Open in IMG/M |
| 3300009870|Ga0131092_10257504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1746 | Open in IMG/M |
| 3300009870|Ga0131092_10613179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300009870|Ga0131092_11038831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 659 | Open in IMG/M |
| 3300009870|Ga0131092_11404587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300009873|Ga0131077_10513297 | Not Available | 1106 | Open in IMG/M |
| 3300010311|Ga0116254_1107158 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010327|Ga0116246_10336671 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010340|Ga0116250_10081638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 2181 | Open in IMG/M |
| 3300010340|Ga0116250_10179067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300010340|Ga0116250_10337559 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300010340|Ga0116250_10506841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300010340|Ga0116250_10530923 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010340|Ga0116250_10671450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300010347|Ga0116238_10477736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. W1-6 | 795 | Open in IMG/M |
| 3300010347|Ga0116238_10982006 | Not Available | 506 | Open in IMG/M |
| 3300010348|Ga0116255_10088147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2475 | Open in IMG/M |
| 3300010352|Ga0116247_10827966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri | 685 | Open in IMG/M |
| 3300010353|Ga0116236_10518376 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300010353|Ga0116236_11386593 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010356|Ga0116237_10713145 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010357|Ga0116249_11523616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 594 | Open in IMG/M |
| 3300010372|Ga0114984_1041058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae | 1250 | Open in IMG/M |
| 3300011593|Ga0122758_100236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42 | 14540 | Open in IMG/M |
| 3300012533|Ga0138256_10652456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 828 | Open in IMG/M |
| 3300014005|Ga0121051_12761 | Not Available | 552 | Open in IMG/M |
| 3300014727|Ga0121476_106161 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300014833|Ga0119870_1181278 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300014961|Ga0134526_1035431 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300018405|Ga0194138_10071001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1498 | Open in IMG/M |
| 3300019213|Ga0179950_1208719 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300019221|Ga0179941_1018452 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300024051|Ga0222423_1083825 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025526|Ga0208492_1041349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300025587|Ga0208938_1012980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2869 | Open in IMG/M |
| 3300025589|Ga0209409_1061671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1048 | Open in IMG/M |
| 3300025613|Ga0208461_1060682 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300025638|Ga0208198_1091488 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300025691|Ga0208826_1159636 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025858|Ga0209099_1229213 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300026284|Ga0209792_1002728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7006 | Open in IMG/M |
| 3300027794|Ga0209480_10131998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1117 | Open in IMG/M |
| 3300027959|Ga0209477_1078885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1177 | Open in IMG/M |
| 3300028804|Ga0268298_10088063 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300033997|Ga0310131_024250 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 47.15% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 8.13% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 6.50% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 4.06% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 4.06% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.25% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 2.44% |
| Wastewater Bioreactor | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor | 1.63% |
| Wastewater | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater | 1.63% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 1.63% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.81% |
| Watersheds | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.81% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.81% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.81% |
| Petroleum Reservoir | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Petroleum Reservoir | 0.81% |
| Ant Dump | Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump | 0.81% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.81% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.81% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.81% |
| Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 0.81% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.81% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.81% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified → Wastewater Treatment | 0.81% |
| Wastewater Plasmid Pools | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools | 0.81% |
| City Subway Metal/Plastic | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic | 0.81% |
| City Subway Metal | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal | 0.81% |
| City Subway Wood | Engineered → Built Environment → City → Subway → Unclassified → City Subway Wood | 0.81% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.81% |
| Wastewater Bioreactor | Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor | 0.81% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.81% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2013843001 | Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Morges-2007 (PGA) | Engineered | Open in IMG/M |
| 3300000052 | Coal bed methane well microbial communities from Alberta, Canada | Engineered | Open in IMG/M |
| 3300001096 | Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge | Engineered | Open in IMG/M |
| 3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300002596 | Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10 | Engineered | Open in IMG/M |
| 3300003408 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan | Engineered | Open in IMG/M |
| 3300003764 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/23/2012_ DNA | Engineered | Open in IMG/M |
| 3300003767 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA | Engineered | Open in IMG/M |
| 3300003844 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor_6/25/2014_ DNA | Engineered | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005076 | Combined Assembly of Gp0111534, Gp0111535, Gp0111536 | Engineered | Open in IMG/M |
| 3300005080 | Combined Assembly of Gp0111534, Gp0111535, Gp0111536, Gp0111537, Gp0111539, Gp0111540, Gp0111541, Gp0111542, Gp0111543 | Engineered | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005819 | Microbial communities of produced water from Jiangsu Oil field in Yangzhou, China - Well_W15 | Environmental | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300007281 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B | Engineered | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300008070 | Wastewater microbial communities from the hospital sewers in Singapore - Hospital 2 | Engineered | Open in IMG/M |
| 3300008071 | Wastewater microbial communities from the domestic sewers in Singapore - Site 1 | Engineered | Open in IMG/M |
| 3300009070 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2) | Engineered | Open in IMG/M |
| 3300009196 | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February | Environmental | Open in IMG/M |
| 3300009351 | Microbial communities from sand-filter backwash in Singapore swimming pools - PR-1 | Engineered | Open in IMG/M |
| 3300009501 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 2_5/28/2013_ DNA (PacBio error correction) | Engineered | Open in IMG/M |
| 3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
| 3300009653 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG | Engineered | Open in IMG/M |
| 3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009663 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009668 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009711 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG | Engineered | Open in IMG/M |
| 3300009712 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG | Engineered | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009761 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC129_MetaG | Engineered | Open in IMG/M |
| 3300009769 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010311 | AD_JPTRca | Engineered | Open in IMG/M |
| 3300010327 | AD_CNMVca | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010348 | AD_HKYLca | Engineered | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010372 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day1 | Environmental | Open in IMG/M |
| 3300011593 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway wood -P00382 | Engineered | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300014005 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00768 | Engineered | Open in IMG/M |
| 3300014727 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00260 | Engineered | Open in IMG/M |
| 3300014833 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage | Engineered | Open in IMG/M |
| 3300014961 | Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747 | Engineered | Open in IMG/M |
| 3300018405 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T2_14 | Environmental | Open in IMG/M |
| 3300019213 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019221 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300024051 | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0 | Host-Associated | Open in IMG/M |
| 3300025526 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Mar_CSW14AB (SPAdes) | Environmental | Open in IMG/M |
| 3300025587 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025589 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025691 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026284 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027794 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027959 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes) | Engineered | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300033997 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PLMO_259200 | 2013843001 | Wastewater Plasmid Pools | ARRMRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE |
| Draft_0615274 | 3300000052 | Hydrocarbon Resource Environments | RRRRVGLNAGLDPKAKRKRPDLDKGAAHEKALGHGSGAALQE* |
| JGI11944J13513_10540061 | 3300001096 | Wastewater Bioreactor | VGLNAELDPKAKKERPDLEKGAAHAKALGHRSGAALQKR* |
| Draft_100285066 | 3300001592 | Hydrocarbon Resource Environments | MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSGAALQK* |
| Draft_103522031 | 3300001592 | Hydrocarbon Resource Environments | RVGLSAELDPKAKRERPDLEKGAAHEKPLRHRSDATLQE* |
| JGI24219J26650_10057201 | 3300002098 | Lentic | LTAELDPKAKRERPALTTCAAQEKALGHGSGAALQE* |
| C687J26845_100014129 | 3300002223 | Soil | VVGCDEQLDPKAKRGRPDLKTGAAQEKAPRHGSGATLQK* |
| draft_13534511 | 3300002596 | Hydrocarbon Resource Environments | RRRRVGLSAGLDPKAKRERPDLKKGAAHEKALRHGSGAALQ* |
| JGI26524J50256_100248314 | 3300003408 | Wastewater Bioreactor | MRVRLSAELDPKAKRERPALKKGAAHEKALGHGSGAALQE* |
| Ga0056910_10060792 | 3300003764 | Wastewater Treatment | MRVRLTAELDPKAKRRRPDLDKGAAHQKALGHESGAVLRE* |
| Ga0056910_10060793 | 3300003764 | Wastewater Treatment | MRVRLTAELDPKAKRERPALKKGAAHEKPLGHESGAALQEG* |
| Ga0056910_10075573 | 3300003764 | Wastewater Treatment | RMRVRLTAELDPKAKRRRPDLDKGAAHEKALGHGSGAALQK* |
| Ga0056910_10239452 | 3300003764 | Wastewater Treatment | MRVRLTAKLDPKAKRKRPDLDKGAAHEKALGHGSGAVLQE* |
| Ga0056908_10045106 | 3300003767 | Wastewater Treatment | MRVRLTAELDPKAKRKRPDRDKGAAHEKALGHESGAALQEG* |
| Ga0056908_10048726 | 3300003767 | Wastewater Treatment | MRVRLTAELDPKAKRVRPDLKTGATHEKALRHGSGAALQE* |
| Ga0056914_100248954 | 3300003844 | Wastewater Treatment | MRVRLTAELDPKAKRERPALKMCAAHEKALGHGSGAALQEG* |
| Ga0063356_1021246402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVRLSAELDPKAKREHPEVETGAADAKALRHGSGAALQER* |
| Ga0063356_1038938942 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RRRVGLNAELDPKAKKGRPDREKGAAHAKALGHRSGTALQE* |
| Ga0063356_1049071671 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AARRRRVGLNAELDPKAKKERPALEKGAAHSKALGHRSGTALQE** |
| Ga0063356_1049799331 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGEVLQE* |
| Ga0069612_101234211 | 3300005076 | Wastewater Bioreactor | MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG* |
| Ga0069611_100818701 | 3300005080 | Wastewater Bioreactor | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQER* |
| Ga0073900_100165267 | 3300005659 | Activated Sludge | MRVRLTAELDPKAKRGRPDLDKGAAHEKALGHESGAALQEG* |
| Ga0073904_100912935 | 3300005660 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAVLQE* |
| Ga0073904_102669501 | 3300005660 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQA* |
| Ga0073904_106099882 | 3300005660 | Activated Sludge | MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSDAALQEG* |
| Ga0078536_1012156 | 3300005819 | Petroleum Reservoir | AKLDPKAKRKRPDLDKGAAHQKALGHESGAALQE* |
| Ga0075156_101191852 | 3300005982 | Wastewater Effluent | LNAELDPKAKRERPDLDKGAAHAKALGHESGAALQE* |
| Ga0075156_102495642 | 3300005982 | Wastewater Effluent | VVCPCFSGLDPKAKRERPDLNKGAAHEKALGHESGAALQE* |
| Ga0075156_103036232 | 3300005982 | Wastewater Effluent | MRVRLTAELDPKAKRERPDLKMCAAQEKPLGHESGAALQE* |
| Ga0075154_105622041 | 3300005989 | Wastewater Effluent | RRVGLTAMLDPKAERERPDLKTGAAHEKALRHGSDAALQE* |
| Ga0082021_10943342 | 3300006092 | Wastewater Treatment Plant | MRVRLTAELDPKAKRKRPDLDKGAAHQKALGHESGAALQE* |
| Ga0104349_10583531 | 3300007281 | Aeration Tank Of Activated Sludge Process | RRVRLNAELDPKAKKERPDLKKGAAHEKALGHRSGAALQE* |
| Ga0105679_102817392 | 3300007790 | Soil | AARRRRVGLSAELDPKAKRERPDLETGTTHEKALGHKSGAALQE* |
| Ga0110938_10066921 | 3300008070 | Wastewater | MRVRLTAELDPKAKRERPDLKTGAAHEKALGHGSGAALQ |
| Ga0110933_10891002 | 3300008071 | Wastewater | MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSG |
| Ga0066256_10457563 | 3300009070 | Wastewater Bioreactor | LSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE* |
| Ga0103745_100237082 | 3300009196 | Wastewater Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQK* |
| Ga0115924_10653421 | 3300009351 | Swimming Pool Sandfilter Backwash | MRVRLTAELDPKANRERPDLKTGAAHEKALGHGSGAALQK* |
| Ga0124838_100085601 | 3300009501 | Wastewater Treatment | MRVRLTAELDPKAKRERPDLKTGAAHEKALGLGSGATLQ |
| Ga0124838_101166711 | 3300009501 | Wastewater Treatment | MRVRLTAELDPKAKRERPDLKTGAAHEKALGLGSSGAAQ |
| Ga0124838_101273962 | 3300009501 | Wastewater Treatment | LNAKLDPKAKKGRPDWEKGAAHEQALGHRSGAALQER* |
| Ga0116175_10187892 | 3300009648 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAVLQE* |
| Ga0116175_10915142 | 3300009648 | Anaerobic Digestor Sludge | LSAGLDPKAKRERPDLDKGAAHEKALGHESGAALQEG* |
| Ga0116175_12146671 | 3300009648 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQDG* |
| Ga0116169_10822731 | 3300009653 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQE* |
| Ga0116169_10999672 | 3300009653 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPDLNKGAAHEKPLGHESGAALQE* |
| Ga0116169_12068402 | 3300009653 | Anaerobic Digestor Sludge | AARRMRVRLSAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE* |
| Ga0116169_12315331 | 3300009653 | Anaerobic Digestor Sludge | RLTAGLDPKAKRGRTDLKKGAAHEKALGHESGAALQE* |
| Ga0116169_13148801 | 3300009653 | Anaerobic Digestor Sludge | LIAELDPKAKRERPALKKGAAHEKALGHESGAALQE |
| Ga0116169_13163071 | 3300009653 | Anaerobic Digestor Sludge | KPVRLSAELDPKAKKGRPDLKTGTTHAKALGHGSGAALQEG* |
| Ga0116167_10768812 | 3300009654 | Anaerobic Digestor Sludge | LNAELDPKAKKERPDLEKGAAHAKALGHRSGAALQE* |
| Ga0116167_11069941 | 3300009654 | Anaerobic Digestor Sludge | AARRMRVRLTAELDPKAKRERPALKTGAAQEKALGHGSGAALQE* |
| Ga0116179_11992202 | 3300009657 | Anaerobic Digestor Sludge | MRVGLTAELDPKAKRERTDLDQGAAHEKALDHESGAALQEG* |
| Ga0116179_12325721 | 3300009657 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHGSGAALQE* |
| Ga0116188_12600602 | 3300009658 | Anaerobic Digestor Sludge | ARRRRVGLSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE* |
| Ga0116181_10504023 | 3300009663 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPDLKKGAAHQKALGHGSGAALRE* |
| Ga0116181_11389533 | 3300009663 | Anaerobic Digestor Sludge | RRVGLNAGLDPKAKRERPDLDQGAAHEKALGHESGAALQE* |
| Ga0116181_11590251 | 3300009663 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAQEKPLGHGSGAALQEG* |
| Ga0116146_13962842 | 3300009664 | Anaerobic Digestor Sludge | MRVGLNAGLDPKAKRERPDLKKGAAHEKALRHGSGAALQ* |
| Ga0116180_10713563 | 3300009668 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALDKGAAQEKPLGHGSGAALQEG* |
| Ga0116180_11130792 | 3300009668 | Anaerobic Digestor Sludge | LTAELDPKAKRERLDLKTGAAQEKALRHESGEALQE* |
| Ga0116180_11209012 | 3300009668 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDWNKGVAHEKALGHESGAALQE* |
| Ga0116183_11894051 | 3300009670 | Anaerobic Digestor Sludge | AELDPKAKKGRPDLKTGTTHAKALGHGSGAALQE* |
| Ga0116142_100172697 | 3300009685 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE* |
| Ga0116186_12925261 | 3300009689 | Anaerobic Digestor Sludge | LNAELDPKTKKKRPDLDKGAAHEKALGHESGAALQE* |
| Ga0116145_12615991 | 3300009704 | Anaerobic Digestor Sludge | MRVGLNAGLDPKANRERPDLKTGAAHEKELGHGSGAALQEG* |
| Ga0116145_12615992 | 3300009704 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAA |
| Ga0116166_10325616 | 3300009711 | Anaerobic Digestor Sludge | GLSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE* |
| Ga0116165_10624463 | 3300009712 | Anaerobic Digestor Sludge | RRRRVGLSAKLDPKARRERPALKKGAAHEKALGQGSGAVLQE* |
| Ga0116165_11872782 | 3300009712 | Anaerobic Digestor Sludge | VRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE* |
| Ga0116189_12889751 | 3300009714 | Anaerobic Digestor Sludge | RLTAELDPKAKRERPALKKGAAHEKPLGHGSGAALQEG* |
| Ga0116168_11205521 | 3300009761 | Anaerobic Digestor Sludge | VRLSAELDPKAKRGRPALKTCAAHEKALGHGSGAALQE* |
| Ga0116184_104416882 | 3300009769 | Anaerobic Digestor Sludge | IAELDPKAKRERPDLDQGAAHEKALGHESGAALQE* |
| Ga0116154_104071301 | 3300009776 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAALQE* |
| Ga0116157_106516221 | 3300009782 | Anaerobic Digestor Sludge | LNAGLDPKAKRERPDLDKGAAHEKALGHESGAALQK* |
| Ga0131092_100616736 | 3300009870 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQE* |
| Ga0131092_101641533 | 3300009870 | Activated Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE* |
| Ga0131092_102370675 | 3300009870 | Activated Sludge | AARRRRVGLNAELDPKAKRERPAREKGAAQAKALGHRSGAALQE* |
| Ga0131092_102575042 | 3300009870 | Activated Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHESGAALQEG* |
| Ga0131092_106131791 | 3300009870 | Activated Sludge | LNAGLDPKAKRERPDLDKGAAHEKALGHESGAALQKW* |
| Ga0131092_110388312 | 3300009870 | Activated Sludge | MRVRLTAELDPKAKRKRPDWDKGAAHEKPLGHESGAALQE* |
| Ga0131092_114045871 | 3300009870 | Activated Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAVLQE* |
| Ga0131077_105132971 | 3300009873 | Wastewater | GCDEMLDTMAKRERPDLETGATHEKAQRHGSGAAPQER* |
| Ga0116254_11071582 | 3300010311 | Anaerobic Digestor Sludge | LNAELDPKAKKGRSDLEKGAAHAKALGHRSGAALQER* |
| Ga0116246_103366711 | 3300010327 | Anaerobic Digestor Sludge | AELDPKAKRERPALKMCAAQEKPLGHGSGAALQEG* |
| Ga0116250_100816385 | 3300010340 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDWDKGAAHQKALGHGSGAALQE* |
| Ga0116250_101790671 | 3300010340 | Anaerobic Digestor Sludge | TAELDPKAKRERPTLKKGAAHEKALGQGSGAVLQE* |
| Ga0116250_103375593 | 3300010340 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPTLKKGAAHEKALGQGSGAVLQE* |
| Ga0116250_105068411 | 3300010340 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPDLNKGAAHEKALGHENGAVLQE* |
| Ga0116250_105309231 | 3300010340 | Anaerobic Digestor Sludge | MRVRLTAELDPKANKKRPDLDKGAAHEKALDHESGAVLQK* |
| Ga0116250_106714502 | 3300010340 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRRRPDLDKGAAHEKALGHGSGAALQE* |
| Ga0116238_104777362 | 3300010347 | Anaerobic Digestor Sludge | RRRVGSNAELDPKAKKERPALERGAAHEKALGHRSDAALQER* |
| Ga0116238_109820061 | 3300010347 | Anaerobic Digestor Sludge | MRVGLNAGLDPKANRERPDLKTGAAHEKALGHGSGAALQK* |
| Ga0116255_100881475 | 3300010348 | Anaerobic Digestor Sludge | RRRVGLNAELDPKAKRERPDLQKGAAHEKALGHESGAAQQE* |
| Ga0116247_108279661 | 3300010352 | Anaerobic Digestor Sludge | RLTAELDPKAKRERPDLNKGAAHEKALGHESGAALQE* |
| Ga0116236_105183761 | 3300010353 | Anaerobic Digestor Sludge | RQNSRDHNRHTSLNAGLDPKAKRERPDLNKGAAHEKALGHESGAALQE* |
| Ga0116236_113865931 | 3300010353 | Anaerobic Digestor Sludge | ARRRRVGLNAELDPKAKRERPELKNSAAHEKVLGHESGAAPQE* |
| Ga0116237_107131451 | 3300010356 | Anaerobic Digestor Sludge | RMRVRLTAELDPKAKRVRPALKTCAAHEKALGHGSGAALQE* |
| Ga0116249_115236161 | 3300010357 | Anaerobic Digestor Sludge | NVVCPCFSGLDPKAKRERPDLNKGAAHEKALGHESGAALQEG* |
| Ga0114984_10410583 | 3300010372 | Deep Subsurface | LNAGLDPKAKRERPDVDKGAAHEKALGHESGAALQE* |
| Ga0122758_10023616 | 3300011593 | City Subway Wood | MRVRLTAELDPKAKRERPDMDKGAAHEKALGHESGAALQE* |
| Ga0138256_106524561 | 3300012533 | Active Sludge | NAGLDPKAKRVRPALKTCAAHEKPLGHESGAALQE* |
| Ga0121051_127611 | 3300014005 | City Subway Metal | LSAELDPKAKRKRPDLDKGAAHEKALGHESGAALQE |
| Ga0121476_1061612 | 3300014727 | City Subway Metal/Plastic | GLNAELDPKAKRERTDLDQGAAHEKALGHESGAALQE* |
| Ga0119870_11812781 | 3300014833 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHKSGAVLQK* |
| Ga0134526_10354311 | 3300014961 | Wastewater | PVRLTAELDPKAKRERLDLKTHATHENALRHGSGEALQE* |
| Ga0194138_100710011 | 3300018405 | Watersheds | CFLRDPKAKRGRTDLKKGAAHEKALGHESGAALQE |
| Ga0179950_12087192 | 3300019213 | Anaerobic Digestor Sludge | ARRRRVGLSAELDPKAKRERLDLRTGATHEKALRHGSGAALQE |
| Ga0179941_10184521 | 3300019221 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKPLGHGSDAAL |
| Ga0222423_10838252 | 3300024051 | Ant Dump | RRRVGLSAELDPKAKRERPDLEKGAAHEKTLCHGSGAALQE |
| Ga0208492_10413492 | 3300025526 | Serpentinite Rock And Fluid | MRVRLTAELDPKANRERPDLKTGAAHEKALGHGSGAALQK |
| Ga0208938_10129805 | 3300025587 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAVLQE |
| Ga0209409_10616712 | 3300025589 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE |
| Ga0208461_10606821 | 3300025613 | Anaerobic Digestor Sludge | PVRLSAELDPKAKRGRPALKTCAAHEKALGHGSGAALQE |
| Ga0208198_10914881 | 3300025638 | Anaerobic Digestor Sludge | LNAELDPKAKKGRSDLEKGAAHAKALGHRSGAALQER |
| Ga0208826_11596362 | 3300025691 | Anaerobic Digestor Sludge | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHGSGAALQE |
| Ga0209099_12292132 | 3300025858 | Anaerobic Digestor Sludge | LNAELDPKAKRERPDLDKGAAHEKALGHGSGAALQEG |
| Ga0209792_10027283 | 3300026284 | Wastewater Treatment | MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHESGAALQEG |
| Ga0209480_101319982 | 3300027794 | Wastewater Effluent | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQEG |
| Ga0209477_10788852 | 3300027959 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG |
| Ga0268298_100880633 | 3300028804 | Activated Sludge | MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAVLQE |
| Ga0310131_024250_4_126 | 3300033997 | Fracking Water | MRVRLTAELDPKAKRERPALKKGAAQEKALGHESGAALQE |
| ⦗Top⦘ |