| Basic Information | |
|---|---|
| Family ID | F006009 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 384 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR |
| Number of Associated Samples | 293 |
| Number of Associated Scaffolds | 384 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.55 % |
| % of genes near scaffold ends (potentially truncated) | 16.93 % |
| % of genes from short scaffolds (< 2000 bps) | 79.43 % |
| Associated GOLD sequencing projects | 264 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.448 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.281 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 384 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 1.82 |
| PF13709 | DUF4159 | 1.30 |
| PF13673 | Acetyltransf_10 | 1.04 |
| PF09472 | MtrF | 1.04 |
| PF13602 | ADH_zinc_N_2 | 0.78 |
| PF01494 | FAD_binding_3 | 0.78 |
| PF00144 | Beta-lactamase | 0.78 |
| PF04909 | Amidohydro_2 | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF02033 | RBFA | 0.78 |
| PF13714 | PEP_mutase | 0.78 |
| PF00378 | ECH_1 | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| PF01980 | TrmO | 0.78 |
| PF07715 | Plug | 0.78 |
| PF13356 | Arm-DNA-bind_3 | 0.52 |
| PF03795 | YCII | 0.52 |
| PF01341 | Glyco_hydro_6 | 0.52 |
| PF13840 | ACT_7 | 0.52 |
| PF00801 | PKD | 0.52 |
| PF00005 | ABC_tran | 0.52 |
| PF01850 | PIN | 0.52 |
| PF01571 | GCV_T | 0.52 |
| PF00246 | Peptidase_M14 | 0.52 |
| PF13417 | GST_N_3 | 0.52 |
| PF07470 | Glyco_hydro_88 | 0.52 |
| PF13084 | DUF3943 | 0.52 |
| PF00313 | CSD | 0.52 |
| PF12697 | Abhydrolase_6 | 0.52 |
| PF09351 | DUF1993 | 0.52 |
| PF00072 | Response_reg | 0.52 |
| PF13432 | TPR_16 | 0.52 |
| PF00903 | Glyoxalase | 0.52 |
| PF05050 | Methyltransf_21 | 0.52 |
| PF12833 | HTH_18 | 0.52 |
| PF02733 | Dak1 | 0.52 |
| PF03061 | 4HBT | 0.52 |
| PF13091 | PLDc_2 | 0.52 |
| PF00152 | tRNA-synt_2 | 0.52 |
| PF00135 | COesterase | 0.52 |
| PF02798 | GST_N | 0.52 |
| PF07209 | DUF1415 | 0.52 |
| PF06026 | Rib_5-P_isom_A | 0.26 |
| PF01343 | Peptidase_S49 | 0.26 |
| PF03551 | PadR | 0.26 |
| PF12680 | SnoaL_2 | 0.26 |
| PF00380 | Ribosomal_S9 | 0.26 |
| PF01938 | TRAM | 0.26 |
| PF05762 | VWA_CoxE | 0.26 |
| PF13372 | Alginate_exp | 0.26 |
| PF06348 | DUF1059 | 0.26 |
| PF01336 | tRNA_anti-codon | 0.26 |
| PF05893 | LuxC | 0.26 |
| PF03965 | Penicillinase_R | 0.26 |
| PF06762 | LMF1 | 0.26 |
| PF01053 | Cys_Met_Meta_PP | 0.26 |
| PF12681 | Glyoxalase_2 | 0.26 |
| PF12762 | DDE_Tnp_IS1595 | 0.26 |
| PF01872 | RibD_C | 0.26 |
| PF13147 | Obsolete Pfam Family | 0.26 |
| PF02574 | S-methyl_trans | 0.26 |
| PF00572 | Ribosomal_L13 | 0.26 |
| PF12893 | Lumazine_bd_2 | 0.26 |
| PF11684 | DUF3280 | 0.26 |
| PF01797 | Y1_Tnp | 0.26 |
| PF13411 | MerR_1 | 0.26 |
| PF01844 | HNH | 0.26 |
| PF00350 | Dynamin_N | 0.26 |
| PF00472 | RF-1 | 0.26 |
| PF00078 | RVT_1 | 0.26 |
| PF08281 | Sigma70_r4_2 | 0.26 |
| PF00856 | SET | 0.26 |
| PF04542 | Sigma70_r2 | 0.26 |
| PF12796 | Ank_2 | 0.26 |
| PF07364 | DUF1485 | 0.26 |
| PF03544 | TonB_C | 0.26 |
| PF13302 | Acetyltransf_3 | 0.26 |
| PF00854 | PTR2 | 0.26 |
| PF16884 | ADH_N_2 | 0.26 |
| PF02586 | SRAP | 0.26 |
| PF13517 | FG-GAP_3 | 0.26 |
| PF02782 | FGGY_C | 0.26 |
| PF12543 | DUF3738 | 0.26 |
| PF00076 | RRM_1 | 0.26 |
| PF13289 | SIR2_2 | 0.26 |
| PF04828 | GFA | 0.26 |
| PF12840 | HTH_20 | 0.26 |
| PF14026 | DUF4242 | 0.26 |
| PF01244 | Peptidase_M19 | 0.26 |
| PF13924 | Lipocalin_5 | 0.26 |
| PF02653 | BPD_transp_2 | 0.26 |
| PF08874 | DUF1835 | 0.26 |
| PF00520 | Ion_trans | 0.26 |
| PF13645 | YkuD_2 | 0.26 |
| PF01614 | IclR | 0.26 |
| PF13489 | Methyltransf_23 | 0.26 |
| PF12695 | Abhydrolase_5 | 0.26 |
| PF07228 | SpoIIE | 0.26 |
| PF05717 | TnpB_IS66 | 0.26 |
| PF02768 | DNA_pol3_beta_3 | 0.26 |
| PF13103 | TonB_2 | 0.26 |
| PF00440 | TetR_N | 0.26 |
| PF13646 | HEAT_2 | 0.26 |
| PF04452 | Methyltrans_RNA | 0.26 |
| PF10027 | DUF2269 | 0.26 |
| PF07681 | DoxX | 0.26 |
| PF05170 | AsmA | 0.26 |
| PF01219 | DAGK_prokar | 0.26 |
| PF01322 | Cytochrom_C_2 | 0.26 |
| PF00043 | GST_C | 0.26 |
| PF13360 | PQQ_2 | 0.26 |
| PF03695 | UPF0149 | 0.26 |
| PF13515 | FUSC_2 | 0.26 |
| PF08439 | Peptidase_M3_N | 0.26 |
| PF13401 | AAA_22 | 0.26 |
| PF00528 | BPD_transp_1 | 0.26 |
| PF01408 | GFO_IDH_MocA | 0.26 |
| PF09720 | Unstab_antitox | 0.26 |
| PF10150 | RNase_E_G | 0.26 |
| PF13450 | NAD_binding_8 | 0.26 |
| PF13499 | EF-hand_7 | 0.26 |
| PF00753 | Lactamase_B | 0.26 |
| PF10974 | DUF2804 | 0.26 |
| PF02687 | FtsX | 0.26 |
| PF13291 | ACT_4 | 0.26 |
| PF13676 | TIR_2 | 0.26 |
| PF08570 | DUF1761 | 0.26 |
| PF07690 | MFS_1 | 0.26 |
| PF13442 | Cytochrome_CBB3 | 0.26 |
| PF04185 | Phosphoesterase | 0.26 |
| PF00326 | Peptidase_S9 | 0.26 |
| PF16925 | TetR_C_13 | 0.26 |
| PF00106 | adh_short | 0.26 |
| PF02604 | PhdYeFM_antitox | 0.26 |
| PF13483 | Lactamase_B_3 | 0.26 |
| PF01042 | Ribonuc_L-PSP | 0.26 |
| PF00892 | EamA | 0.26 |
| PF02661 | Fic | 0.26 |
| PF00589 | Phage_integrase | 0.26 |
| PF05159 | Capsule_synth | 0.26 |
| PF01288 | HPPK | 0.26 |
| PF13031 | DUF3892 | 0.26 |
| PF05096 | Glu_cyclase_2 | 0.26 |
| PF07731 | Cu-oxidase_2 | 0.26 |
| PF13528 | Glyco_trans_1_3 | 0.26 |
| PF00701 | DHDPS | 0.26 |
| PF02517 | Rce1-like | 0.26 |
| PF00990 | GGDEF | 0.26 |
| PF07676 | PD40 | 0.26 |
| PF14329 | DUF4386 | 0.26 |
| PF00069 | Pkinase | 0.26 |
| PF02738 | MoCoBD_1 | 0.26 |
| PF05649 | Peptidase_M13_N | 0.26 |
| PF12844 | HTH_19 | 0.26 |
| PF05960 | DUF885 | 0.26 |
| PF01812 | 5-FTHF_cyc-lig | 0.26 |
| PF10604 | Polyketide_cyc2 | 0.26 |
| PF07549 | Sec_GG | 0.26 |
| PF13628 | DUF4142 | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 384 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.56 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.04 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.78 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.78 |
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.52 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG3310 | Uncharacterized conserved protein, DUF1415 family | Function unknown [S] | 0.52 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.52 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.26 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.26 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.26 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.26 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.26 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.26 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.26 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.26 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.26 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.26 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.26 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.26 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.26 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.26 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG0818 | Diacylglycerol kinase | Lipid transport and metabolism [I] | 0.26 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.26 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.26 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.26 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.26 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.26 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.26 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.26 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.26 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.26 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.26 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.26 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.26 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.26 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.26 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.26 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.26 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 0.26 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 0.26 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.26 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG3562 | Capsule polysaccharide modification protein KpsS | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG3563 | Capsule polysaccharide export protein KpsC/LpsZ | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.26 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.26 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.26 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.26 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.26 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.26 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.26 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.26 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.26 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.97 % |
| Unclassified | root | N/A | 32.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9294540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3991 | Open in IMG/M |
| 2228664021|ICCgaii200_c0958571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
| 3300000156|NODE_c0679246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2994 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101528974 | Not Available | 506 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101529726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37 | 1397 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101575615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300000787|JGI11643J11755_11611839 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300000787|JGI11643J11755_11628044 | Not Available | 551 | Open in IMG/M |
| 3300000890|JGI11643J12802_10467658 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300000956|JGI10216J12902_102405587 | Not Available | 527 | Open in IMG/M |
| 3300000956|JGI10216J12902_103298200 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Trichomonascaceae → Blastobotrys → Blastobotrys adeninivorans | 1061 | Open in IMG/M |
| 3300000956|JGI10216J12902_108417971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300000956|JGI10216J12902_108971309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300000956|JGI10216J12902_110656511 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108600908 | Not Available | 640 | Open in IMG/M |
| 3300001372|YBBDRAFT_1117092 | Not Available | 684 | Open in IMG/M |
| 3300001546|JGI12659J15293_10022138 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300001593|JGI12635J15846_10908523 | Not Available | 502 | Open in IMG/M |
| 3300002568|C688J35102_120976168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4206 | Open in IMG/M |
| 3300002854|pct2_10000111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 201625 | Open in IMG/M |
| 3300003267|soilL1_10073760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4224 | Open in IMG/M |
| 3300003408|JGI26524J50256_1025892 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10330708 | Not Available | 620 | Open in IMG/M |
| 3300003972|Ga0064067_1108496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 1453 | Open in IMG/M |
| 3300003990|Ga0055455_10026736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1463 | Open in IMG/M |
| 3300004022|Ga0055432_10166689 | Not Available | 619 | Open in IMG/M |
| 3300004080|Ga0062385_10062634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella | 1663 | Open in IMG/M |
| 3300004080|Ga0062385_10671677 | Not Available | 664 | Open in IMG/M |
| 3300004082|Ga0062384_100079987 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300004082|Ga0062384_100370108 | Not Available | 914 | Open in IMG/M |
| 3300004091|Ga0062387_100021535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 2676 | Open in IMG/M |
| 3300004092|Ga0062389_100497138 | Not Available | 1366 | Open in IMG/M |
| 3300004092|Ga0062389_101831672 | Not Available | 786 | Open in IMG/M |
| 3300004114|Ga0062593_101935373 | Not Available | 653 | Open in IMG/M |
| 3300004114|Ga0062593_102288132 | Not Available | 607 | Open in IMG/M |
| 3300004152|Ga0062386_101187307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. DHG33 | 634 | Open in IMG/M |
| 3300004463|Ga0063356_100465238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1657 | Open in IMG/M |
| 3300004463|Ga0063356_100569359 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300004463|Ga0063356_101387949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300004463|Ga0063356_103449089 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300004635|Ga0062388_102087796 | Not Available | 588 | Open in IMG/M |
| 3300005093|Ga0062594_101908608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 630 | Open in IMG/M |
| 3300005219|Ga0069004_10273182 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005260|Ga0074072_1003983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 7958 | Open in IMG/M |
| 3300005294|Ga0065705_10818254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005331|Ga0070670_100055076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3414 | Open in IMG/M |
| 3300005332|Ga0066388_107740550 | Not Available | 538 | Open in IMG/M |
| 3300005335|Ga0070666_10255443 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300005340|Ga0070689_101565820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300005344|Ga0070661_101055066 | Not Available | 676 | Open in IMG/M |
| 3300005347|Ga0070668_100432017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1129 | Open in IMG/M |
| 3300005347|Ga0070668_101563508 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005354|Ga0070675_100730387 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005367|Ga0070667_102133087 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005441|Ga0070700_100723178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300005454|Ga0066687_10679289 | Not Available | 612 | Open in IMG/M |
| 3300005457|Ga0070662_100553378 | Not Available | 964 | Open in IMG/M |
| 3300005459|Ga0068867_101431640 | Not Available | 642 | Open in IMG/M |
| 3300005541|Ga0070733_10239626 | Not Available | 1191 | Open in IMG/M |
| 3300005542|Ga0070732_10081793 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300005544|Ga0070686_100675791 | Not Available | 821 | Open in IMG/M |
| 3300005548|Ga0070665_101597648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005577|Ga0068857_100830919 | Not Available | 883 | Open in IMG/M |
| 3300005591|Ga0070761_10050137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2348 | Open in IMG/M |
| 3300005610|Ga0070763_10271507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300005617|Ga0068859_101016357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
| 3300005617|Ga0068859_103165915 | Not Available | 501 | Open in IMG/M |
| 3300005718|Ga0068866_11398780 | Not Available | 511 | Open in IMG/M |
| 3300005719|Ga0068861_100134634 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2009 | Open in IMG/M |
| 3300005719|Ga0068861_100258136 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300005836|Ga0074470_10475099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2330 | Open in IMG/M |
| 3300005836|Ga0074470_10873600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
| 3300005843|Ga0068860_101801765 | Not Available | 634 | Open in IMG/M |
| 3300005844|Ga0068862_100022681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5253 | Open in IMG/M |
| 3300005844|Ga0068862_100635492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300005844|Ga0068862_102371710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 542 | Open in IMG/M |
| 3300005937|Ga0081455_10003695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17523 | Open in IMG/M |
| 3300005994|Ga0066789_10005671 | All Organisms → cellular organisms → Bacteria | 5501 | Open in IMG/M |
| 3300006046|Ga0066652_100785833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 909 | Open in IMG/M |
| 3300006049|Ga0075417_10011730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3279 | Open in IMG/M |
| 3300006052|Ga0075029_100300352 | Not Available | 1025 | Open in IMG/M |
| 3300006162|Ga0075030_100117697 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300006237|Ga0097621_100412428 | Not Available | 1211 | Open in IMG/M |
| 3300006237|Ga0097621_100689628 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300006354|Ga0075021_10219817 | Not Available | 1163 | Open in IMG/M |
| 3300006638|Ga0075522_10393412 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006791|Ga0066653_10239945 | Not Available | 923 | Open in IMG/M |
| 3300006844|Ga0075428_100000016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 149842 | Open in IMG/M |
| 3300006844|Ga0075428_100084840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3455 | Open in IMG/M |
| 3300006844|Ga0075428_101099599 | All Organisms → cellular organisms → Eukaryota → Sar | 840 | Open in IMG/M |
| 3300006845|Ga0075421_100380017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1700 | Open in IMG/M |
| 3300006845|Ga0075421_100963727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae | 968 | Open in IMG/M |
| 3300006845|Ga0075421_101946668 | Not Available | 628 | Open in IMG/M |
| 3300006846|Ga0075430_100932545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Halioglobus → unclassified Halioglobus → Halioglobus sp. | 715 | Open in IMG/M |
| 3300006847|Ga0075431_100238746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1849 | Open in IMG/M |
| 3300006852|Ga0075433_10499418 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300006853|Ga0075420_100135345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2167 | Open in IMG/M |
| 3300006871|Ga0075434_102362446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 534 | Open in IMG/M |
| 3300006893|Ga0073928_10596126 | Not Available | 781 | Open in IMG/M |
| 3300006893|Ga0073928_11181138 | Not Available | 516 | Open in IMG/M |
| 3300006918|Ga0079216_10392428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 868 | Open in IMG/M |
| 3300006948|Ga0099826_10135752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1428 | Open in IMG/M |
| 3300006953|Ga0074063_10016330 | Not Available | 890 | Open in IMG/M |
| 3300006969|Ga0075419_11184595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 563 | Open in IMG/M |
| 3300007004|Ga0079218_10394019 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300007004|Ga0079218_12920271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300007004|Ga0079218_13020935 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300007004|Ga0079218_13902808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 507 | Open in IMG/M |
| 3300007982|Ga0102924_1353684 | Not Available | 567 | Open in IMG/M |
| 3300009094|Ga0111539_11357786 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009100|Ga0075418_10946439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudolysobacter → Pseudolysobacter antarcticus | 932 | Open in IMG/M |
| 3300009100|Ga0075418_12453608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300009100|Ga0075418_12847210 | Not Available | 528 | Open in IMG/M |
| 3300009148|Ga0105243_10469453 | Not Available | 1185 | Open in IMG/M |
| 3300009148|Ga0105243_11848491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300009162|Ga0075423_13227089 | Not Available | 500 | Open in IMG/M |
| 3300009176|Ga0105242_11448834 | Not Available | 716 | Open in IMG/M |
| 3300009448|Ga0114940_10171109 | Not Available | 960 | Open in IMG/M |
| 3300009448|Ga0114940_10465675 | Not Available | 560 | Open in IMG/M |
| 3300009500|Ga0116229_10775659 | Not Available | 779 | Open in IMG/M |
| 3300009527|Ga0114942_1129839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RB56-2 | 861 | Open in IMG/M |
| 3300009545|Ga0105237_10259987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1739 | Open in IMG/M |
| 3300009551|Ga0105238_10016818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7416 | Open in IMG/M |
| 3300009609|Ga0105347_1417839 | Not Available | 578 | Open in IMG/M |
| 3300009678|Ga0105252_10380252 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009698|Ga0116216_10771584 | Not Available | 577 | Open in IMG/M |
| 3300009701|Ga0116228_11063838 | Not Available | 537 | Open in IMG/M |
| 3300009714|Ga0116189_1000815 | All Organisms → cellular organisms → Bacteria | 26110 | Open in IMG/M |
| 3300009840|Ga0126313_10430397 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300010040|Ga0126308_10732625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 681 | Open in IMG/M |
| 3300010044|Ga0126310_10940529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300010044|Ga0126310_11854879 | Not Available | 503 | Open in IMG/M |
| 3300010049|Ga0123356_10030120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5079 | Open in IMG/M |
| 3300010361|Ga0126378_11181880 | Not Available | 863 | Open in IMG/M |
| 3300010362|Ga0126377_10004234 | All Organisms → cellular organisms → Bacteria | 10391 | Open in IMG/M |
| 3300010362|Ga0126377_10016769 | All Organisms → cellular organisms → Bacteria | 5923 | Open in IMG/M |
| 3300010362|Ga0126377_10030578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4547 | Open in IMG/M |
| 3300010375|Ga0105239_11093599 | Not Available | 918 | Open in IMG/M |
| 3300010375|Ga0105239_12219704 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010376|Ga0126381_100721706 | Not Available | 1426 | Open in IMG/M |
| 3300010392|Ga0118731_103397984 | Not Available | 748 | Open in IMG/M |
| 3300011227|Ga0137475_100112 | All Organisms → cellular organisms → Bacteria | 10853 | Open in IMG/M |
| 3300011270|Ga0137391_10433918 | Not Available | 1119 | Open in IMG/M |
| 3300011439|Ga0137432_1027561 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300011441|Ga0137452_1076424 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300011443|Ga0137457_1218667 | Not Available | 651 | Open in IMG/M |
| 3300012179|Ga0137334_1131640 | Not Available | 566 | Open in IMG/M |
| 3300012232|Ga0137435_1133431 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012353|Ga0137367_10714786 | Not Available | 697 | Open in IMG/M |
| 3300012829|Ga0160467_100066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 156141 | Open in IMG/M |
| 3300012891|Ga0157305_10240198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → unclassified Methylococcus → Methylococcus sp. BF19-07 | 540 | Open in IMG/M |
| 3300012906|Ga0157295_10209031 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012913|Ga0157298_10266222 | Not Available | 589 | Open in IMG/M |
| 3300012925|Ga0137419_10657854 | Not Available | 846 | Open in IMG/M |
| 3300012927|Ga0137416_10032904 | All Organisms → cellular organisms → Bacteria | 3475 | Open in IMG/M |
| 3300012929|Ga0137404_10031267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 3940 | Open in IMG/M |
| 3300012951|Ga0164300_10211413 | Not Available | 958 | Open in IMG/M |
| 3300012984|Ga0164309_10191157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1400 | Open in IMG/M |
| 3300012985|Ga0164308_10106461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1984 | Open in IMG/M |
| 3300012988|Ga0164306_11588669 | Not Available | 563 | Open in IMG/M |
| 3300013296|Ga0157374_12523122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300013297|Ga0157378_11980126 | Not Available | 632 | Open in IMG/M |
| 3300013306|Ga0163162_10965907 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300013306|Ga0163162_11703026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 720 | Open in IMG/M |
| 3300013306|Ga0163162_13380526 | Not Available | 510 | Open in IMG/M |
| 3300014158|Ga0181521_10198409 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300014162|Ga0181538_10066133 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300014168|Ga0181534_10963820 | Not Available | 513 | Open in IMG/M |
| 3300014325|Ga0163163_10220845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1943 | Open in IMG/M |
| 3300014325|Ga0163163_10707712 | Not Available | 1071 | Open in IMG/M |
| 3300014326|Ga0157380_10310561 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300014326|Ga0157380_10678093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300014326|Ga0157380_11381633 | Not Available | 754 | Open in IMG/M |
| 3300014489|Ga0182018_10053973 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300014492|Ga0182013_10007496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12009 | Open in IMG/M |
| 3300014495|Ga0182015_10007179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10938 | Open in IMG/M |
| 3300014501|Ga0182024_10338506 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300014501|Ga0182024_12233112 | Not Available | 598 | Open in IMG/M |
| 3300014875|Ga0180083_1106242 | Not Available | 616 | Open in IMG/M |
| 3300014884|Ga0180104_1003516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3303 | Open in IMG/M |
| 3300015206|Ga0167644_1001341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 17921 | Open in IMG/M |
| 3300015206|Ga0167644_1004552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7932 | Open in IMG/M |
| 3300015264|Ga0137403_10022867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6685 | Open in IMG/M |
| 3300015371|Ga0132258_11378012 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300015373|Ga0132257_101779852 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300015374|Ga0132255_103215575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300016445|Ga0182038_11291928 | Not Available | 652 | Open in IMG/M |
| 3300017565|Ga0182745_1328933 | Not Available | 649 | Open in IMG/M |
| 3300017651|Ga0182742_1211868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 681 | Open in IMG/M |
| 3300017948|Ga0187847_10295445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300017973|Ga0187780_10184875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300018033|Ga0187867_10243586 | Not Available | 1014 | Open in IMG/M |
| 3300018034|Ga0187863_10291297 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300018034|Ga0187863_10657768 | Not Available | 591 | Open in IMG/M |
| 3300018042|Ga0187871_10788123 | Not Available | 530 | Open in IMG/M |
| 3300018043|Ga0187887_10194706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter aalborgensis | 1206 | Open in IMG/M |
| 3300018043|Ga0187887_10875724 | Not Available | 531 | Open in IMG/M |
| 3300018072|Ga0184635_10212968 | Not Available | 769 | Open in IMG/M |
| 3300018422|Ga0190265_10422248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087 | 1435 | Open in IMG/M |
| 3300018422|Ga0190265_10507762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
| 3300018422|Ga0190265_10790606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
| 3300018422|Ga0190265_10821632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas | 1052 | Open in IMG/M |
| 3300018422|Ga0190265_11354077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 827 | Open in IMG/M |
| 3300018422|Ga0190265_11640691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter violaceus → Gloeobacter violaceus PCC 7421 | 754 | Open in IMG/M |
| 3300018422|Ga0190265_12128920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300018422|Ga0190265_13140952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 551 | Open in IMG/M |
| 3300018429|Ga0190272_10395690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1125 | Open in IMG/M |
| 3300018429|Ga0190272_10870067 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300018429|Ga0190272_11448225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. Y57 | 694 | Open in IMG/M |
| 3300018429|Ga0190272_12993988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300018429|Ga0190272_13066777 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018465|Ga0190269_10204481 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300018465|Ga0190269_11156371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300018468|Ga0066662_10240922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas kyeonggiensis | 1469 | Open in IMG/M |
| 3300018469|Ga0190270_11678125 | Not Available | 689 | Open in IMG/M |
| 3300018476|Ga0190274_10104019 | Not Available | 2267 | Open in IMG/M |
| 3300018476|Ga0190274_10967328 | Not Available | 923 | Open in IMG/M |
| 3300018476|Ga0190274_13065438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300019362|Ga0173479_10042899 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300019377|Ga0190264_10659383 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300019377|Ga0190264_10718449 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300019377|Ga0190264_11541887 | Not Available | 580 | Open in IMG/M |
| 3300019377|Ga0190264_11719496 | Not Available | 559 | Open in IMG/M |
| 3300019458|Ga0187892_10000053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 241955 | Open in IMG/M |
| 3300020034|Ga0193753_10017630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4297 | Open in IMG/M |
| 3300020034|Ga0193753_10042495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2481 | Open in IMG/M |
| 3300020034|Ga0193753_10148102 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300020061|Ga0193716_1012031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4434 | Open in IMG/M |
| 3300020067|Ga0180109_1396047 | Not Available | 801 | Open in IMG/M |
| 3300020580|Ga0210403_10011075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7325 | Open in IMG/M |
| 3300020580|Ga0210403_10054892 | All Organisms → cellular organisms → Bacteria | 3187 | Open in IMG/M |
| 3300020580|Ga0210403_10329450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300020581|Ga0210399_10059707 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300020582|Ga0210395_10000050 | All Organisms → cellular organisms → Bacteria | 119471 | Open in IMG/M |
| 3300020582|Ga0210395_10922861 | Not Available | 648 | Open in IMG/M |
| 3300021168|Ga0210406_10057443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3385 | Open in IMG/M |
| 3300021170|Ga0210400_10961739 | Not Available | 695 | Open in IMG/M |
| 3300021402|Ga0210385_10328746 | Not Available | 1138 | Open in IMG/M |
| 3300021405|Ga0210387_10002987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12980 | Open in IMG/M |
| 3300021407|Ga0210383_10347625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
| 3300021407|Ga0210383_10495727 | Not Available | 1055 | Open in IMG/M |
| 3300021432|Ga0210384_10212971 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300021478|Ga0210402_10066112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3188 | Open in IMG/M |
| 3300021559|Ga0210409_10010329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 9400 | Open in IMG/M |
| 3300021560|Ga0126371_11077586 | Not Available | 943 | Open in IMG/M |
| 3300022549|Ga0212091_10299308 | Not Available | 659 | Open in IMG/M |
| 3300022873|Ga0224550_1014970 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300022878|Ga0247761_1114095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300022894|Ga0247778_1003599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3837 | Open in IMG/M |
| 3300022894|Ga0247778_1220811 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300022897|Ga0247764_1002810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 6014 | Open in IMG/M |
| 3300022897|Ga0247764_1058973 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300022903|Ga0247774_1036400 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300023270|Ga0247784_1000050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 41504 | Open in IMG/M |
| 3300023270|Ga0247784_1151890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300023274|Ga0247763_1072662 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300024222|Ga0247691_1048390 | Not Available | 643 | Open in IMG/M |
| 3300024988|Ga0209958_1015168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 2465 | Open in IMG/M |
| 3300024989|Ga0209952_1024349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 1575 | Open in IMG/M |
| 3300025509|Ga0208848_1046951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 925 | Open in IMG/M |
| 3300025552|Ga0210142_1010991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300025903|Ga0207680_10443192 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025904|Ga0207647_10011396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6235 | Open in IMG/M |
| 3300025918|Ga0207662_10667243 | Not Available | 727 | Open in IMG/M |
| 3300025923|Ga0207681_10362284 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1163 | Open in IMG/M |
| 3300025925|Ga0207650_11000460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300025930|Ga0207701_11636076 | Not Available | 517 | Open in IMG/M |
| 3300025938|Ga0207704_10523763 | Not Available | 959 | Open in IMG/M |
| 3300025961|Ga0207712_11474572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora phatthalungensis | 609 | Open in IMG/M |
| 3300025961|Ga0207712_11894790 | Not Available | 534 | Open in IMG/M |
| 3300025972|Ga0207668_10071754 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
| 3300026035|Ga0207703_11428072 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026067|Ga0207678_11669965 | Not Available | 560 | Open in IMG/M |
| 3300026116|Ga0207674_10706347 | Not Available | 973 | Open in IMG/M |
| 3300026121|Ga0207683_10349239 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300026142|Ga0207698_12669340 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027559|Ga0209222_1066752 | Not Available | 692 | Open in IMG/M |
| 3300027591|Ga0209733_1045940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1161 | Open in IMG/M |
| 3300027652|Ga0209007_1192723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300027660|Ga0209736_1110098 | Not Available | 745 | Open in IMG/M |
| 3300027666|Ga0209282_1247544 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027729|Ga0209248_10206570 | Not Available | 579 | Open in IMG/M |
| 3300027773|Ga0209810_1091678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300027829|Ga0209773_10131559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1039 | Open in IMG/M |
| 3300027853|Ga0209274_10188166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300027855|Ga0209693_10194214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300027867|Ga0209167_10419300 | Not Available | 730 | Open in IMG/M |
| 3300027880|Ga0209481_10002654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7398 | Open in IMG/M |
| 3300027880|Ga0209481_10018701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans | 3046 | Open in IMG/M |
| 3300027886|Ga0209486_10230046 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300027894|Ga0209068_10166876 | Not Available | 1198 | Open in IMG/M |
| 3300027895|Ga0209624_10001552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17802 | Open in IMG/M |
| 3300027902|Ga0209048_10585286 | Not Available | 745 | Open in IMG/M |
| 3300027905|Ga0209415_10527476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp. | 900 | Open in IMG/M |
| 3300027907|Ga0207428_10561915 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300027908|Ga0209006_10631435 | Not Available | 882 | Open in IMG/M |
| 3300027909|Ga0209382_10189290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2365 | Open in IMG/M |
| 3300027909|Ga0209382_10893294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae | 936 | Open in IMG/M |
| 3300028047|Ga0209526_10993253 | Not Available | 502 | Open in IMG/M |
| 3300028380|Ga0268265_10002398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Candidatus Viadribacter → Candidatus Viadribacter manganicus | 14165 | Open in IMG/M |
| 3300028536|Ga0137415_10036533 | All Organisms → cellular organisms → Bacteria | 4822 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1086873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. Har01 | 1497 | Open in IMG/M |
| 3300028574|Ga0302153_10085947 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300028731|Ga0302301_1082146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300028747|Ga0302219_10007775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4064 | Open in IMG/M |
| 3300028747|Ga0302219_10099827 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300028747|Ga0302219_10205970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 759 | Open in IMG/M |
| 3300028748|Ga0302156_10058155 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300028780|Ga0302225_10567639 | Not Available | 527 | Open in IMG/M |
| 3300028783|Ga0302279_10056656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2322 | Open in IMG/M |
| 3300028786|Ga0307517_10329455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300028795|Ga0302227_10130551 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300028798|Ga0302222_10113491 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300028802|Ga0307503_10271210 | Not Available | 838 | Open in IMG/M |
| 3300028828|Ga0307312_10835673 | Not Available | 610 | Open in IMG/M |
| 3300029913|Ga0311362_10720203 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300029951|Ga0311371_11585545 | Not Available | 722 | Open in IMG/M |
| 3300029953|Ga0311343_11290648 | Not Available | 551 | Open in IMG/M |
| 3300029956|Ga0302150_10131935 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300029956|Ga0302150_10231044 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300029992|Ga0302276_10245680 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300030013|Ga0302178_10340446 | Not Available | 681 | Open in IMG/M |
| 3300030042|Ga0302300_1126510 | Not Available | 749 | Open in IMG/M |
| 3300030058|Ga0302179_10046490 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300030509|Ga0302183_10040030 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300030520|Ga0311372_10380851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2154 | Open in IMG/M |
| 3300030520|Ga0311372_11088739 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300030520|Ga0311372_12113301 | Not Available | 653 | Open in IMG/M |
| 3300030573|Ga0210272_1311672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1 | 511 | Open in IMG/M |
| 3300030738|Ga0265462_11205452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300030763|Ga0265763_1019946 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031226|Ga0307497_10050581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300031226|Ga0307497_10300828 | Not Available | 736 | Open in IMG/M |
| 3300031229|Ga0299913_10080247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3165 | Open in IMG/M |
| 3300031231|Ga0170824_116743039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1853 | Open in IMG/M |
| 3300031232|Ga0302323_101089199 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300031234|Ga0302325_12041407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300031236|Ga0302324_100216021 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300031366|Ga0307506_10162047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031455|Ga0307505_10054307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300031455|Ga0307505_10210366 | Not Available | 899 | Open in IMG/M |
| 3300031456|Ga0307513_10014455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9631 | Open in IMG/M |
| 3300031507|Ga0307509_10001463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 39971 | Open in IMG/M |
| 3300031547|Ga0310887_10134473 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300031548|Ga0307408_100018971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4625 | Open in IMG/M |
| 3300031708|Ga0310686_101949477 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300031708|Ga0310686_109868373 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300031708|Ga0310686_112669078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300031708|Ga0310686_114411580 | All Organisms → cellular organisms → Bacteria | 5389 | Open in IMG/M |
| 3300031824|Ga0307413_11245529 | Not Available | 649 | Open in IMG/M |
| 3300031858|Ga0310892_10331238 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300031901|Ga0307406_10333233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1179 | Open in IMG/M |
| 3300031903|Ga0307407_10474267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 913 | Open in IMG/M |
| 3300031903|Ga0307407_11484672 | Not Available | 536 | Open in IMG/M |
| 3300031908|Ga0310900_10466564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300031908|Ga0310900_10647086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300031944|Ga0310884_10124615 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300031962|Ga0307479_10261967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1708 | Open in IMG/M |
| 3300031995|Ga0307409_100859882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300032002|Ga0307416_103379903 | Not Available | 534 | Open in IMG/M |
| 3300032004|Ga0307414_11440637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. Root179 | 640 | Open in IMG/M |
| 3300032004|Ga0307414_11833720 | Not Available | 566 | Open in IMG/M |
| 3300032005|Ga0307411_10126334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. Root241 | 1861 | Open in IMG/M |
| 3300032012|Ga0310902_10174418 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300032012|Ga0310902_10335391 | Not Available | 942 | Open in IMG/M |
| 3300032013|Ga0310906_10688378 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032074|Ga0308173_10451417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300032074|Ga0308173_11598804 | Not Available | 613 | Open in IMG/M |
| 3300032126|Ga0307415_102573985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF313 | 502 | Open in IMG/M |
| 3300032144|Ga0315910_10379808 | Not Available | 1080 | Open in IMG/M |
| 3300032157|Ga0315912_10019860 | All Organisms → cellular organisms → Bacteria | 5510 | Open in IMG/M |
| 3300032895|Ga0335074_11019095 | Not Available | 727 | Open in IMG/M |
| 3300033158|Ga0335077_10002574 | All Organisms → cellular organisms → Bacteria | 21680 | Open in IMG/M |
| 3300033407|Ga0214472_10758674 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300033412|Ga0310810_11059217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300033417|Ga0214471_10097852 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300033551|Ga0247830_10799946 | Not Available | 750 | Open in IMG/M |
| 3300034115|Ga0364945_0012284 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300034129|Ga0370493_0339011 | Not Available | 521 | Open in IMG/M |
| 3300034147|Ga0364925_0170108 | Not Available | 796 | Open in IMG/M |
| 3300034199|Ga0370514_157537 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300034668|Ga0314793_031111 | Not Available | 896 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.34% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.04% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.04% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.04% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.04% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.04% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.78% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.52% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.26% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.26% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.26% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.26% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.26% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.26% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.26% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.26% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.26% |
| Filter Cake Produced In Cane Sugar Milling Plant | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant | 0.26% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.26% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.26% |
| Insecta | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta | 0.26% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.26% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.26% |
| Lignocellulose-Degrading Enriched | Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Lignocellulose-Degrading Enriched | 0.26% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002854 | Lignocellulose-degrading enriched microbial communities from Concordia, Entre Rios, Argentina - CMC-Pine-T2-ill-ass | Engineered | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003408 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan | Engineered | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003972 | Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011227 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 10 - S13.1.50.a - transect 1, age 50 years, surface depth). | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017565 | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft BY (version 2) | Environmental | Open in IMG/M |
| 3300017651 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300022878 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L111-311C-4 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300022897 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4 | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024988 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes) | Engineered | Open in IMG/M |
| 3300024989 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_750_biof (SPAdes) | Engineered | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_00254850 | 2088090015 | Soil | MTPGEQKMLNRGVAAGTLIGLVMGGLIALFIAMKPEFFAALLH |
| ICCgaii200_09585712 | 2228664021 | Soil | VEVEVTPNEQKVLWRGVAAGTLIGLALGLMIALVIAIRPELFRALLQ |
| NODE_06792463 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | TEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG* |
| INPhiseqgaiiFebDRAFT_1015289742 | 3300000364 | Soil | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPEFFAGLIQ* |
| INPhiseqgaiiFebDRAFT_1015297262 | 3300000364 | Soil | MTNGEQKVLVRGVAAGTIIGLAIGLMLALFIAMKPGFFAGLIQ* |
| INPhiseqgaiiFebDRAFT_1015756152 | 3300000364 | Soil | MTPGERKMLNRGVAAGTLVGLAIGLMFALAIAMRPEFFAALLR* |
| JGI11643J11755_116118391 | 3300000787 | Soil | MTTSEQKVFWRGVAAGIMVGLPVGLMIALFIAIRPELFRGL* |
| JGI11643J11755_116280442 | 3300000787 | Soil | MPWEVEMTPSEQKILWRGVAAGTMVGVVVGLMIALFIVIRPDLFRALIP* |
| JGI11643J12802_104676582 | 3300000890 | Soil | MTPGEQKMLNRGVAAGTLIGLVMGGLIALFIAMKPEFFAALLH* |
| JGI10216J12902_1024055872 | 3300000956 | Soil | MTNGEHKMLLRGVAGGTLMGMVLGLMLALVIALKPEFFAG |
| JGI10216J12902_1032982002 | 3300000956 | Soil | MTDGEQKMLMRGVAAGTLMGVALGLMLALAIALRPEFFARLN* |
| JGI10216J12902_1084179712 | 3300000956 | Soil | MTAGEQKMLYRGVAAGTIMGMAIGLLIALFIALRPEFFAALLR* |
| JGI10216J12902_1089713092 | 3300000956 | Soil | MTNGEKKMLAAGTIVGLVIGGMIALVIAMKPELFAGLIQ* |
| JGI10216J12902_1106565113 | 3300000956 | Soil | MTDGEHKMLLKGVAAGTLMGVALGLMLALAIALRPEFFARLN* |
| JGIcombinedJ13530_1086009081 | 3300001213 | Wetland | VTSGEQKMLMRGVAGGTIMGLALGLIIALFIAMRPDLFAGLIR* |
| YBBDRAFT_11170921 | 3300001372 | Marine Estuarine | KLLWRGVAAGTLIGLAVGLMIALFIAIRPELFRALIP* |
| JGI12659J15293_100221382 | 3300001546 | Forest Soil | MTNGEQKVLWRGVAAGTIVGLGLGLMIALFIAMKAGLFAGLTQ* |
| JGI12635J15846_109085232 | 3300001593 | Forest Soil | MTNGEQKMLARGVAAGTIMGVAIGLIIALFIEMKPELFAGLIQ* |
| C688J35102_1209761682 | 3300002568 | Soil | MTMTTNEKKVLWRGVAAGTIVGVVVALMIALFIAVRLGLHSGTA* |
| pct2_10000111122 | 3300002854 | Lignocellulose-Degrading Enriched | MTNAEQKMLKRGVAAGTLMGLALGGIIALFIALRPDFFAALLL* |
| soilL1_100737602 | 3300003267 | Sugarcane Root And Bulk Soil | MTAGEQKMLYRGVAAGTLIGLALGLMLALVIQMRPELFAALLR* |
| JGI26524J50256_10258922 | 3300003408 | Wastewater Bioreactor | MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG* |
| JGIcombinedJ51221_103307081 | 3300003505 | Forest Soil | MTNSEEKVLWRGVAAGTLMGLAFGLMIALFIATKPELFAALVR* |
| Ga0064067_11084962 | 3300003972 | Filter Cake Produced In Cane Sugar Milling Plant | MTHGEQKALWRGVAAGTMVGLAIGGMIALVIATKPGFFAALLQ* |
| Ga0055455_100267361 | 3300003990 | Natural And Restored Wetlands | MTNGEQKMLWRGVAAGTIMGLAIGGLIALVIAMKPELIAGLIQ* |
| Ga0055432_101666891 | 3300004022 | Natural And Restored Wetlands | MTTSEQKVRWRGVAAGIMIGLAVGLIIALFIAIRPELFRALTP* |
| Ga0062385_100626344 | 3300004080 | Bog Forest Soil | MTTSEQNVFRRGVAAGTIMGLALGLMIALFIAIRPELFRALIP* |
| Ga0062385_106716771 | 3300004080 | Bog Forest Soil | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRPELFRALIP* |
| Ga0062384_1000799872 | 3300004082 | Bog Forest Soil | LTTSEQKVFRRGVAAGTIMGLALGLMIALFIAVRPDLFRALIP* |
| Ga0062384_1003701082 | 3300004082 | Bog Forest Soil | MWHGFAFGEVEMTTSEQNVFRRGVAAGTIMGLALGLMIALFIAIRPELFRALIP* |
| Ga0062387_1000215352 | 3300004091 | Bog Forest Soil | MTTGEQKVLARGVAAGTIVGVAVGLMIALFIAIRPDLFRALIP* |
| Ga0062389_1000191242 | 3300004092 | Bog Forest Soil | MDSHVLREVELTTSEQKVFRRGVAAGTIMGLALGLMIALFIAVRPDLFRALIP* |
| Ga0062389_1004971383 | 3300004092 | Bog Forest Soil | MTTSEQKVLWRGVAAGTIMGLAVGLMIALFIAIRPELFRALIP* |
| Ga0062389_1018316721 | 3300004092 | Bog Forest Soil | MTKTEQKLLWRGVAAGTTVGLALGLMIALFIAMKPELFAGLIR* |
| Ga0062593_1019353731 | 3300004114 | Soil | MTTSEQKVLARGVAAGIMIGLAVGLMIALFIAIRPELFRALIP* |
| Ga0062593_1022881321 | 3300004114 | Soil | MTTSEQKVLWRGVAAGTLVGLALGGMIALAILIRPELFRALMP* |
| Ga0062386_1011873072 | 3300004152 | Bog Forest Soil | MTNGEQRVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR* |
| Ga0063356_1004652382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPGEQKFLYRGVAAGTLIGLALGLMIALAIAVKPEFFAVLLR* |
| Ga0063356_1005693591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTASEQKVFWRGVAAGTMVGLAVGLILALCIAIRPELFGALIP* |
| Ga0063356_1013879492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPSEQKVLWRGVAAGTLVGLAIGGLIALMIAIRPELFRALLS* |
| Ga0063356_1034490891 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTTSEQRALWRGVAAGTIVGLAAGLMLALFIAIRPELFSALIP* |
| Ga0062388_1020877962 | 3300004635 | Bog Forest Soil | GSPWRCEMTNGEQKVLWRGVAAGTIVGLALGLMTALFIAMKPELFAGLIR* |
| Ga0062594_1019086082 | 3300005093 | Soil | MTNSEEKLLKRGVAAGTLVGLAVGGMIALFIAMKPEFFAALVR* |
| Ga0069004_102731822 | 3300005219 | Natural And Restored Wetlands | MTSGEHKMLLRGVVGGTIIGLALGLIVALPVATKPELFAGLVL* |
| Ga0074072_10039839 | 3300005260 | Soil | MTTGERKILLRGVAGGTMMGLALGLMIALVIAIKPHLFAGLIH* |
| Ga0065705_108182541 | 3300005294 | Switchgrass Rhizosphere | VEVEVTPNEQKVLWRGVAAGTLIGLALGLMIALVIAIRPELFRALLQ* |
| Ga0070670_1000550765 | 3300005331 | Switchgrass Rhizosphere | MTNNEQKVLVRGVAAGTIMGVAIGLVLALVIAMKPAFFAGLVHYV* |
| Ga0066388_1077405502 | 3300005332 | Tropical Forest Soil | MTSGEQKVLWRGVAAGTLVGLAIGGMIALVIAMEPELFAGLIR* |
| Ga0070666_102554432 | 3300005335 | Switchgrass Rhizosphere | MTDGEQKALWRGVAAGTMVGLAFGLMIALFIAMKPELFAGLIR* |
| Ga0070689_1015658201 | 3300005340 | Switchgrass Rhizosphere | MTNGEQKVLVRGVAAGTIMGVAIGLMLALFIAMKPEFFAGLNL* |
| Ga0070661_1010550661 | 3300005344 | Corn Rhizosphere | MTNGEKKVLTRGLAAGTILGLAIGLMIALFIAMKPELFAGLIR* |
| Ga0070668_1004320172 | 3300005347 | Switchgrass Rhizosphere | MTNAEEKVLKRGVAAGTLVGLAIGGMIALFIAMRPELFAALIR* |
| Ga0070668_1015635081 | 3300005347 | Switchgrass Rhizosphere | MTNGEQKMLWRGVAAGAVMGLAIGGMIALVIAMKPALFAGLIQ* |
| Ga0070675_1007303872 | 3300005354 | Miscanthus Rhizosphere | MTNGEQKVLVRGVAAGTIMGVAIGLMLALFIAMKPDFFAGLIL* |
| Ga0070667_1021330872 | 3300005367 | Switchgrass Rhizosphere | MTDGEQKALWRGVAAGTMVGLAFGLMIALFIAMKPELFAGLIQ* |
| Ga0070700_1007231781 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LTWEYGRISVPWEFEMTTSEKKMLAAGTLMGVVIGLMIALFITIRPELFR* |
| Ga0066687_106792892 | 3300005454 | Soil | MTTSEQKVLWRGVAAGTIVGLAVGLMIALFIAISSGRNCLGL* |
| Ga0070662_1005533781 | 3300005457 | Corn Rhizosphere | MTPSERKVLARGVAAGTIVGVVVGLMIALLIAIRPELFRALTP* |
| Ga0068867_1014316402 | 3300005459 | Miscanthus Rhizosphere | MTNGEQKMLVRGVAGGTIMGVAIGLMLALFIAMKPDFFAGLIL* |
| Ga0070733_102396263 | 3300005541 | Surface Soil | MTKGEQKVLARGVAAGSIIGLAVGLMLALFIAIRPELFRALIQ* |
| Ga0070732_100817932 | 3300005542 | Surface Soil | MTTGEQKILRRGVAAGTLLGLAIGGIIALFIAMKPALLAALVR* |
| Ga0070686_1006757911 | 3300005544 | Switchgrass Rhizosphere | MTNGEQKMAWRGIAAGTIMGLALGLIIALFVAIRPELFAALRF* |
| Ga0070665_1015976483 | 3300005548 | Switchgrass Rhizosphere | LYRGLAAGTLIGLALGLMIALAIAVKPEFFAAVLR* |
| Ga0068857_1008309192 | 3300005577 | Corn Rhizosphere | MTTSEQKVLWRGVAAGIMIGLAVGLMIALVIAIRPELLRALIP* |
| Ga0070761_100501373 | 3300005591 | Soil | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAIKPELFAGLIR* |
| Ga0070763_102715072 | 3300005610 | Soil | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRPDLFRALIP* |
| Ga0068859_1010163572 | 3300005617 | Switchgrass Rhizosphere | VPWEIEMTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLMR* |
| Ga0068859_1031659151 | 3300005617 | Switchgrass Rhizosphere | TPGEQKFLYRGVAAGTLIGLALGLMIALAIAVKPEFFAAVLR* |
| Ga0068866_113987802 | 3300005718 | Miscanthus Rhizosphere | VRWEIEMTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLMR* |
| Ga0068861_1001346341 | 3300005719 | Switchgrass Rhizosphere | MTNGEQKMLVRGVAAGTLAGLAIGLMIALSVAIRPELFAGLIQ* |
| Ga0068861_1002581363 | 3300005719 | Switchgrass Rhizosphere | MTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLMR* |
| Ga0074470_104750992 | 3300005836 | Sediment (Intertidal) | MTTSEQKLLWRGVAAGTLIGLAVGLMIALFIAIRPELFRALIP* |
| Ga0074470_108736001 | 3300005836 | Sediment (Intertidal) | MTNGEQKMLWRGVAAGTMVDLAIGLMIALVIAMNPQLFSGLVQ* |
| Ga0068860_1018017651 | 3300005843 | Switchgrass Rhizosphere | MLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGLNL* |
| Ga0068862_1000226816 | 3300005844 | Switchgrass Rhizosphere | MTTGEQKALNRGVAAGTLIGVAIGLMIALAIMAKPAFFAALIG* |
| Ga0068862_1006354922 | 3300005844 | Switchgrass Rhizosphere | MTPGEQKFLHRGVAAGTLIGLALGLMIALAIAVKPEFFAAVLR* |
| Ga0068862_1023717102 | 3300005844 | Switchgrass Rhizosphere | MTTSEQRVLWRGVAAGTMVGLVVGLMLALFIAIRPELFRALIP* |
| Ga0081455_100036952 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNGEQKVLVRGVAAGTLLGLTIGLMIALFVALKPGLFSALVQ* |
| Ga0066789_100056713 | 3300005994 | Soil | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR* |
| Ga0066652_1007858331 | 3300006046 | Soil | MTTGEQKVLARGVAAGTIVGLAVGLMIALFIAIRPELFRALIP* |
| Ga0075417_100117302 | 3300006049 | Populus Rhizosphere | MTPGEQKMLNRGVAAGTLIGLVIGGLIALFIAMKPEFFAALLH* |
| Ga0075029_1003003521 | 3300006052 | Watersheds | MTNGEQEMLARGVAAGTILGLAIGLMLALFIGMNPELFAGLIK* |
| Ga0075030_1001176974 | 3300006162 | Watersheds | MTNGEQVVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR* |
| Ga0097621_1004124282 | 3300006237 | Miscanthus Rhizosphere | MTNAEQKVLVRGVTAGTIMGLAIGLMLALFIAMKPEFFAGLIQ* |
| Ga0097621_1006896282 | 3300006237 | Miscanthus Rhizosphere | MTKGEQQVLVRGVAAGTILGLAVGLIIALFIAMKPEFFAGLIH* |
| Ga0075021_102198172 | 3300006354 | Watersheds | MTQGEQKVLVRGVAAGTLMGLGIGLIIALFIAMKPGLFAGLIHLR* |
| Ga0075522_103934122 | 3300006638 | Arctic Peat Soil | MTNREQKVLVRGVSAGMVVGLAIGLMIALFVAIKPEFFAALIR* |
| Ga0066653_102399452 | 3300006791 | Soil | MTNGKQKMLMRGVAAGTIMGVAIGLMLALVVAMKPAFFAGLVHYL* |
| Ga0075428_100000016101 | 3300006844 | Populus Rhizosphere | LEARHDNGEQKMLWRGLAAGTLVGLVIGGMIALVIAVKPELFAGLIQ* |
| Ga0075428_1000848402 | 3300006844 | Populus Rhizosphere | MTPGEQKMLNRGVAAGALIGLVIGGLIALFIAMKPEFFAALLH* |
| Ga0075428_1010995992 | 3300006844 | Populus Rhizosphere | DYLWRCEMTNGEHKMLLRGVAGGTLMGMALGLMLALVIALKPEFFAGLSLYL* |
| Ga0075421_1003800172 | 3300006845 | Populus Rhizosphere | MTKGEEKMLFRGVAAGTLIGLVIGGMIALIIAAKPELFAGLIQ* |
| Ga0075421_1009637272 | 3300006845 | Populus Rhizosphere | MTKGEEKMLFRGVAAGTLIGLVIGGMIALIIAAKPELFAGLIR* |
| Ga0075421_1019466681 | 3300006845 | Populus Rhizosphere | SEEKVLWRGVAAGILIGMALGLMIALVIAIRPELFRGL* |
| Ga0075430_1009325452 | 3300006846 | Populus Rhizosphere | MTKGEHRMLTRGVAAGTLIGLAIGGLIALFIAVKPEFFAGLIQ* |
| Ga0075431_1002387463 | 3300006847 | Populus Rhizosphere | VTPNEQKVLWRGVAAGTLIGLALGLMIALVIAVRPELFRALMQ* |
| Ga0075433_104994181 | 3300006852 | Populus Rhizosphere | CLWEVEMTTSEQKVLARGVAAGIMIGLAVGLMIALFIAIRPELFRARIP* |
| Ga0075420_1001353457 | 3300006853 | Populus Rhizosphere | MRCEMTKGEEKMLFRGVAAGTLIGLVIGGMIALIIAAKPELFAGLIQ* |
| Ga0075434_1023624461 | 3300006871 | Populus Rhizosphere | MTNAEEKVLKRGVAAGTLVGLAIGGMIALFIAMRPELFAALVR* |
| Ga0073928_105961261 | 3300006893 | Iron-Sulfur Acid Spring | MTNGEQKVPWRAVAAGTIVGLALGLMIALFIAIKPELFAGLIR* |
| Ga0073928_111811382 | 3300006893 | Iron-Sulfur Acid Spring | MTKSEEKVLWRGVAAGMLMGLATGLMIALFIAIRPELFRALMP* |
| Ga0079216_103924282 | 3300006918 | Agricultural Soil | MTHGEQRMLWRAVAAGTIIGMAIGGMIALVIAMKPE |
| Ga0099826_101357522 | 3300006948 | Root Nodules | MTNGEQKVLCRGLAAGTLIGVAIGGMIALVIAMKPEVFAGLIR* |
| Ga0074063_100163302 | 3300006953 | Soil | MTNGEKKVLARGLAAGTILGLAVGVIIALFIAMKPEFFAGLIQ* |
| Ga0075419_111845952 | 3300006969 | Populus Rhizosphere | EQKVLWRGVAAGTLTGVAIGLIIALFIAMKPALFASLGFGN* |
| Ga0079218_103940192 | 3300007004 | Agricultural Soil | MTHGEQKFLSRGVAAGTLVGLAIGLMVALFVAMKPHLFAGLFQ* |
| Ga0079218_129202711 | 3300007004 | Agricultural Soil | MTNGEQKVLVRGVAAGTITGLAIGLMLALFIAMKPEFFAGLTQ* |
| Ga0079218_130209351 | 3300007004 | Agricultural Soil | MTDGEHKMLMRGVAGGTLMGVAIGLMLALVIAMKPEFFAGLVQY |
| Ga0079218_139028082 | 3300007004 | Agricultural Soil | MTHGEQKMLWRGVAAGTIIGIAIGGMIALVIAIKPELFAALM* |
| Ga0102924_13536841 | 3300007982 | Iron-Sulfur Acid Spring | MTTGEHRMLVRGVAAGTIMGVVVGLMLALLIAIRPVLFRL |
| Ga0111539_113577861 | 3300009094 | Populus Rhizosphere | MTNGEQKMLWRGVAAGTLIGLAIGGIIALFIAVKPELFAGLIQ* |
| Ga0075418_109464391 | 3300009100 | Populus Rhizosphere | VEVEVTPNEQKVLRRGVAAGILIGLALGLMIALVIAVRPELFRALMQ* |
| Ga0075418_124536082 | 3300009100 | Populus Rhizosphere | MTNGEQKMLWRGVAAGTLIGLAIGGMIALCIAIKPEFFAGLIH* |
| Ga0075418_128472101 | 3300009100 | Populus Rhizosphere | EHKMLLRGVAGGTLMGMALGLMLALVIALKPEFFAGLSRYL* |
| Ga0105243_104694533 | 3300009148 | Miscanthus Rhizosphere | MTNNEQKMLWRGVAAGTVVGLALGLIMALIIAMKPELFAAL* |
| Ga0105243_118484911 | 3300009148 | Miscanthus Rhizosphere | AVAFWGKCEMTNGEQKMLVRGVAGGTIMGVAIGLMLALFIAMKPEFFAGLNL* |
| Ga0075423_132270891 | 3300009162 | Populus Rhizosphere | MTDGEHKMLVRGVAAGTLMGVALGLMLALAIVMKP |
| Ga0105242_114488341 | 3300009176 | Miscanthus Rhizosphere | MTTSEQKVLWRGVAAGIMIGLAVGLMIALFIAIRPELFRALIP* |
| Ga0114940_101711092 | 3300009448 | Groundwater | MLTRGVTAGTVLGLAVGLMIALFIALKPALFAGLIQ* |
| Ga0114940_104656752 | 3300009448 | Groundwater | MTIGEQKMLTRGVAAGTVLGLAVGLMIALLVAMKPAIFAGLIQ* |
| Ga0116229_107756591 | 3300009500 | Host-Associated | MTNGEQKVLWRGVAAGTIMGMAIGLMLALFIAIRPELFAGLAR* |
| Ga0114942_11298391 | 3300009527 | Groundwater | MTNGERKVLVRGVAAGTILGLALGGIIALAIAIRPELLAALFP* |
| Ga0105237_102599872 | 3300009545 | Corn Rhizosphere | MTNGEQKVFWRGVGAGTLLGMVLGLLIALFIEMKPELFAGLIR* |
| Ga0105238_100168182 | 3300009551 | Corn Rhizosphere | MTDGEQKALWRGVAAGTMAGLAFGLMIALFIAMKPELFAGLIR* |
| Ga0105347_14178391 | 3300009609 | Soil | MTNGEQKVLVRGVAAGTLMGVAIGLMIALVIAMKPEFFAGLVQYL* |
| Ga0105252_103802522 | 3300009678 | Soil | TNGEQKMLVRGVAAGTLMGVAMGLMLALVIAIKPEFFAGLIQYL* |
| Ga0116216_107715842 | 3300009698 | Peatlands Soil | MTNGEQKILARGVAAGTITGLALGLMIALFVAMKAEFFAGFFR* |
| Ga0116228_110638381 | 3300009701 | Host-Associated | MTNGEQKVLWRGVAAGTMIGLALGFMIALFIAIKPEVFAGLIR* |
| Ga0116189_10008154 | 3300009714 | Anaerobic Digestor Sludge | MTSGERKMLVRGVAAGTIMGVAIGLIIALFIVIKPEFFAALIR* |
| Ga0126313_104303973 | 3300009840 | Serpentine Soil | MTNGEQQVLVRGVAAGTIVGVALGLMLALVIAMKPDLFATLIQ* |
| Ga0126308_107326252 | 3300010040 | Serpentine Soil | WRGVAAGTLIGLVIGGMTALVIAMKPELFAGLIR* |
| Ga0126310_109405292 | 3300010044 | Serpentine Soil | MTDGEQKVLVRGVAAGTIVGVAIGLMLALVIAMKPDLFARLIQ* |
| Ga0126310_118548791 | 3300010044 | Serpentine Soil | MTNGEKKVLVRGVAAGTLMGLAIGLMLALFIAMKPEFFAGLIR* |
| Ga0123356_1003012010 | 3300010049 | Termite Gut | MTTGEQKLLWYGVAAGTILGLALGLMIALFIAMKPQLFAGLIH* |
| Ga0126378_111818803 | 3300010361 | Tropical Forest Soil | MTTGERKVLYRGVAAGTLMGVAIGLMIALVIAMRPELFAALVR* |
| Ga0126377_100042349 | 3300010362 | Tropical Forest Soil | MFSLWRCDVTNGEQKVLVRGVAAGTIMGVAIGLILALFIVMKPAFFAGLIR* |
| Ga0126377_100167698 | 3300010362 | Tropical Forest Soil | MTSGEQKTFWRGVAAGTILGLVLGLMIALFIAMKPELFAGLIR* |
| Ga0126377_100305782 | 3300010362 | Tropical Forest Soil | MTNDEQKMLWRGVAAGTLMGLAIGGMIALVIAMKPELFAGLIR* |
| Ga0105239_110935993 | 3300010375 | Corn Rhizosphere | MTIGEQKMLWRGVAAGTMVGLAIGLMVALFIAMKPELFAGLIR* |
| Ga0105239_122197041 | 3300010375 | Corn Rhizosphere | WRCEMTNGEQKVFWRGVGAGTLLGMVLGLLIALFIEMKPELFAGLIR* |
| Ga0126381_1007217061 | 3300010376 | Tropical Forest Soil | MTTGEQKVLYRGVAAGTLMGVAIGLMIALVIAMRPELFAALVR* |
| Ga0118731_1033979842 | 3300010392 | Marine | DVKMTKGEQKMLIRGVAAGTIQGVAIGLMIALFIAMKPESFAWLFQ* |
| Ga0137475_10011211 | 3300011227 | Glacier Forefield Soil | MIEGEQKVLTRGLAAGTLIGLAIGLITALFIAMKPSSLQR* |
| Ga0137391_104339183 | 3300011270 | Vadose Zone Soil | MTTSEEKVLWRGVAAGTIMGLALGLMIALFIVIRPELFRALIR* |
| Ga0137432_10275612 | 3300011439 | Soil | MTNGEHKMLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGLNL* |
| Ga0137452_10764242 | 3300011441 | Soil | MTNGEQKMLFRGVAAGTLMGVAIGLMLALVIAMKPEFFAGLN* |
| Ga0137457_12186671 | 3300011443 | Soil | MTTSEQKVLARGVAAGIIVGLAVGLIIALFIAIRPELF |
| Ga0137334_11316402 | 3300012179 | Soil | MTTSEQKVLWRGVAAGIMIGLAVGLMIGLVIAVRPELTAGI |
| Ga0137435_11334312 | 3300012232 | Soil | MTDGEQKVLRRGVAAGTILGLAIGLMIALFIAMKPELFAGLIH* |
| Ga0137367_107147862 | 3300012353 | Vadose Zone Soil | MTNGEQKMLWRGVAAGTLIGLAIGGMIALCIAMKPEFFAGLIQ* |
| Ga0160467_10006687 | 3300012829 | Insecta | MTSGEQKMLVRGVAAGTIMGLALGLMIALCIAMKPQFFAGLIQ* |
| Ga0157305_102401982 | 3300012891 | Soil | VRLLRRREMTNGEHKMLLRGVAGGTLMGMVLGLMLALVIALKPEFFAGLSRYL* |
| Ga0157295_102090312 | 3300012906 | Soil | MTNGEQKVLVRGVAAGTIMGVAIGLMLALFIAMKPEFFAGLIQ* |
| Ga0157298_102662222 | 3300012913 | Soil | MTNGEQKVLVRGVAAGTIMGVAIGLMLALVIAMKPEFFAGLNL* |
| Ga0137419_106578542 | 3300012925 | Vadose Zone Soil | MTDGEKKVLARGLAAGTILGLAIGLIIALFIAMKPGLFAGLIQ* |
| Ga0137416_100329043 | 3300012927 | Vadose Zone Soil | MTNGEQKMLWRGVAAGTLMGIAIGGMIALFIAIKPEFFAGLMQTL* |
| Ga0137404_100312674 | 3300012929 | Vadose Zone Soil | VTKGEQKVLARGVAAGTILGLAIGLVVALFIAMKPELFAGLIR* |
| Ga0164300_102114132 | 3300012951 | Soil | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPEFFPWLIQ* |
| Ga0164309_101911572 | 3300012984 | Soil | MTIGEQKMLARGAAAGALVGLGIGGMIALFIAMKPDLFAAVFL* |
| Ga0164308_101064612 | 3300012985 | Soil | MTIGEQKMLARGAAAGALVGLGIGGIIALFIAMNPDLFAAVFL* |
| Ga0164306_115886692 | 3300012988 | Soil | MTIGEQKMLARGAAAGALVGLGIGGIIALFIAMKPDLFAAVFL* |
| Ga0157374_125231222 | 3300013296 | Miscanthus Rhizosphere | MTASENDMTAGEHKVLIRGVAAGTILGLAIGLITALAIAIRPDVFAALIR* |
| Ga0157378_119801262 | 3300013297 | Miscanthus Rhizosphere | CLWEVEMTTSEEKVLWRGVAAGTLIGVAVGLMIALAITVRPELFRALIP* |
| Ga0163162_109659071 | 3300013306 | Switchgrass Rhizosphere | VEVEVTPNEQKVLWRGVAAGTLIGLALGLMIALVIAVRPELFRALMQ* |
| Ga0163162_117030261 | 3300013306 | Switchgrass Rhizosphere | MSAEQKLLSRGAAAGTMIGLALGGIIALFIAMRPEFFATLFRFL* |
| Ga0163162_133805262 | 3300013306 | Switchgrass Rhizosphere | LWEVEMTTSEQKVLWRGVAAGIMIGLAVGLMIALVIAIRPELLRALIP* |
| Ga0181521_101984092 | 3300014158 | Bog | MTNAEQKVLWRGAAARTIVGLALGLMITLFIAMKPELSAGL |
| Ga0181538_100661335 | 3300014162 | Bog | MTNAEQKVLWRGAAARTIVGLALGLMITLFIAMKPELSAGLIR* |
| Ga0181534_109638201 | 3300014168 | Bog | MTTGEQKMLWRGVAAGTIMGLALGLMIALLVAIRPELFRALIP* |
| Ga0163163_102208452 | 3300014325 | Switchgrass Rhizosphere | MTNNEQKVLVRGVAAGTIMGVAIGLMLALVIAMKPAFFAGLVHYL* |
| Ga0163163_107077123 | 3300014325 | Switchgrass Rhizosphere | VLARGLAAGTILGLAIGLMIALLIAMKPELFAGLIQ* |
| Ga0157380_103105612 | 3300014326 | Switchgrass Rhizosphere | MTNGEQKMLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGLNL* |
| Ga0157380_106780932 | 3300014326 | Switchgrass Rhizosphere | MTNGEQKVLWHGVAAGTILGLAIGGMIALVIAMKPELLAALIQ* |
| Ga0157380_113816332 | 3300014326 | Switchgrass Rhizosphere | MTPGEQKFLHRGAAAGTLIGLALGLMIALAIAVKPEFFAAVLR* |
| Ga0182018_100539733 | 3300014489 | Palsa | MTKGEQRVLARGVAAGTIMGLAIGLIIALFIAVKPGLFAGLIH* |
| Ga0182013_100074966 | 3300014492 | Bog | MTSGEQKMLARGVAAGTILGLAIGLMIALFIAMKPALFAGLIQ* |
| Ga0182015_100071792 | 3300014495 | Palsa | MTNGEQKVLWRGVSAGTIVGLALGLMIALFIAMKPELFAGLIR* |
| Ga0182024_103385061 | 3300014501 | Permafrost | MTNSEQKVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIQ* |
| Ga0182024_122331121 | 3300014501 | Permafrost | SEQKVLWRGVAAGILIGLATGLMIALFIATKPELFRTLVR* |
| Ga0180083_11062421 | 3300014875 | Soil | MTTSEQKVLWRGVAAGILIGVAVGLMIALFIAIRPELFRALIP* |
| Ga0180104_10035163 | 3300014884 | Soil | MTTSEQKVLARGVAAGIMIGLAVGLMIALFIAIRPELFRALIP |
| Ga0167644_10013414 | 3300015206 | Glacier Forefield Soil | MKNGEQKVLWFGVSAGTILGLAIGLMVALFIAMKPGLIH* |
| Ga0167644_100455211 | 3300015206 | Glacier Forefield Soil | MKNGEQKVLWIGVTAGTILGLAIGLMVALFIAMKPGLIH* |
| Ga0137403_100228671 | 3300015264 | Vadose Zone Soil | GSLWRCEVTKGEQKVLARGVAAGTILGLAIGLVVALFIAMKPELFAGLIR* |
| Ga0132258_113780124 | 3300015371 | Arabidopsis Rhizosphere | MTTSEQKMLWRGVAAGTIIGLAIGGMIALVIAMKPELFAGLIR* |
| Ga0132257_1017798522 | 3300015373 | Arabidopsis Rhizosphere | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPEFFPGLIQ* |
| Ga0132255_1032155751 | 3300015374 | Arabidopsis Rhizosphere | MTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLTR* |
| Ga0182038_112919281 | 3300016445 | Soil | MTGGEQKVLVRGVAAGTVMGMAIGLMIALFIAMKPEFFAALFR |
| Ga0182745_13289331 | 3300017565 | Soil | MTGGEQKMLWRGVAAGTLIGIAIGGMIALFIATRPQLLSGLIQ |
| Ga0182742_12118682 | 3300017651 | Compost | MTNGERKALWRGVAAGTMVGLAIGGMIALVIATKPGLFAALLQ |
| Ga0187847_102954452 | 3300017948 | Peatland | MTNGEQKVLWRGVAAGTIVGLTLGLMIALFIAMQPELFAGLIGN |
| Ga0187780_101848752 | 3300017973 | Tropical Peatland | MTSGEQKMLNRGVAAGTIMGLALGLMIALFIAMRPDLFAALVR |
| Ga0187867_102435861 | 3300018033 | Peatland | MTNAEQKVLWRGAAARTIVGLALGLMITLFIAMKPELSAGLIR |
| Ga0187863_102912973 | 3300018034 | Peatland | MTNGEQKVLWRGVAAGTIVGLTLGLMIALFIAMKPELFAGLIGN |
| Ga0187863_106577682 | 3300018034 | Peatland | MTNGEQKMLVRGVAAGTMMGLAIGLITALLIAMKPELFA |
| Ga0187871_107881231 | 3300018042 | Peatland | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRP |
| Ga0187887_101947062 | 3300018043 | Peatland | MTNGEQKVLWRGVAAGTIVGLTLGLMIALFIAMKPELFAGLIGK |
| Ga0187887_108757241 | 3300018043 | Peatland | MTNGEQKMLVRGVAAGTMMGLAIGLITALLIAMKPELFAGMIR |
| Ga0184635_102129681 | 3300018072 | Groundwater Sediment | MTTSEQKVLWRGVAAGILIGLAVGLMIALVIAIRPELTAGIKVGLAVG |
| Ga0190265_104222482 | 3300018422 | Soil | MTNGEQKILMRGVAAGTIMGLAIGGIIALFIAIRPEFFAALIG |
| Ga0190265_105077623 | 3300018422 | Soil | MTHGEQKMLWRGVAAGTIIGMAIGGMIALVIAMKPELFAALM |
| Ga0190265_107906062 | 3300018422 | Soil | MTTGEQKVLWRGVAAGTILGLAIGGMIALVIAMKPELFAGLIQ |
| Ga0190265_108216321 | 3300018422 | Soil | MTSGEKKMLARGIVAGTFIGLAIGGMIALVIAMKPELFAGLIQ |
| Ga0190265_113540772 | 3300018422 | Soil | MTTGEQKMLWRGVAAGTLIGLTIGGMLALVIAMKPELFAGLIQ |
| Ga0190265_116406912 | 3300018422 | Soil | MTNGEQKVLWRGVAAGTVMGVAIGLIIALFIATMPELFAAPVR |
| Ga0190265_121289202 | 3300018422 | Soil | MTPGEQEIFWRGVAAGTLVGLAVGLMIALVIAIRRDLFTALVP |
| Ga0190265_131409522 | 3300018422 | Soil | MTDGEQKMLWRGVAAGTIIGMAIGGMIALVIAMKPELFAGLM |
| Ga0190272_103956902 | 3300018429 | Soil | MTTGEQKLLWRGVAGGTLMGLAIGGIIALFIAVKPDLIAALVQ |
| Ga0190272_108700673 | 3300018429 | Soil | MTSGEHKMLWRGVAGGMVMGLAIGGMIALVIAMKPELFAGLM |
| Ga0190272_114482252 | 3300018429 | Soil | MTQGESKVFWRGVGAGTMTGLGIGLISALFIALRPEFFAALIQ |
| Ga0190272_129939882 | 3300018429 | Soil | MLVRGVAAGTIMGVAIGFMLALFIAMKPEFFAVLIQ |
| Ga0190272_130667771 | 3300018429 | Soil | LWEVEMTPSEQKVLWRGVAAGTLIGLAVGGMIALFIAVRPELFTALIP |
| Ga0190269_102044813 | 3300018465 | Soil | MTHGEQKMLRRGIAAGTLIGLAIGGMVAIIIASRPEIFSSLVQ |
| Ga0190269_111563712 | 3300018465 | Soil | MTNGEQKVLWRGVVAGTIVGLAIGGMLALVIVMKSGLLAG |
| Ga0066662_102409223 | 3300018468 | Grasslands Soil | MTTGEQRVLWRGVAGGTIMGLAIGGILALFIAVRPEFFASLIRY |
| Ga0190270_116781252 | 3300018469 | Soil | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPELFAGLIQYL |
| Ga0190274_101040191 | 3300018476 | Soil | MTDGEQKVLWRGVAAGTLLGLAIGAMIALVIAMKPELFAGLIR |
| Ga0190274_109673282 | 3300018476 | Soil | MTTGEQKMLWRGVAAGTLMGIVIGGMIALFIAIRPELFSALIP |
| Ga0190274_130654382 | 3300018476 | Soil | MLRRGVAAGTLMGVAIGLMIALVIAIRPELFAPLVR |
| Ga0173479_100428992 | 3300019362 | Soil | MTNGEQKVLVRGLAAGTIMGVAIGLMLALFIAMKPEFFAGLNL |
| Ga0190264_106593832 | 3300019377 | Soil | MTNGEQKVLVRGVAAGTMLGLAIGAMIALLIAMKPEFFAGLIQ |
| Ga0190264_107184492 | 3300019377 | Soil | MTDGEQKMLWRGVAAGTMIGLVIGGMIALVIAMKPELFAGLM |
| Ga0190264_115418872 | 3300019377 | Soil | MTTSEEKMLWRGVVAGTLVGLAVGGMIALFIAVRPELFAALIQ |
| Ga0190264_117194962 | 3300019377 | Soil | MTIGERKMLTRGVAAGTILGLAIGLMIALIVAMKPALFAALVQ |
| Ga0187892_1000005343 | 3300019458 | Bio-Ooze | MTDREQRVLERGVAAGTIMGLAIGLLIALFIAMKPEFFAGLIQ |
| Ga0193753_100176306 | 3300020034 | Soil | MTQGEQKFLYRGVAAGTLMGITIGLMIALVVAMKPHLFAGLIQ |
| Ga0193753_100424952 | 3300020034 | Soil | MTNSEQKVLARGVAAGTIVGLAVGLMIALFIAIRPELFRALIP |
| Ga0193753_101481021 | 3300020034 | Soil | MTNGEQKVLVRGVAAGTIMGLAVGLMIALFIAIKPELFAALVR |
| Ga0193716_10120313 | 3300020061 | Soil | MTSGEQKMMVRGLAAGTILGLAIGLIIALFIAIRPDLFRGLIS |
| Ga0180109_13960471 | 3300020067 | Groundwater Sediment | EVEMTTSEQKVLARGVAAGIMIGLAVGLMIALFIAIRPELFRALIP |
| Ga0210403_100110751 | 3300020580 | Soil | MTTSEQKVLARGVAAGTLVGVAAGLMIALFIAIRPDLFRALIP |
| Ga0210403_100548924 | 3300020580 | Soil | MTNSEEKILWRGVAAGMLTGLAIGLMMALFIAIATKPELFAALVR |
| Ga0210403_103294501 | 3300020580 | Soil | MTNSEQKVLWRGVAAGMVVGLATGLMIALFIAIKPDLFAALVR |
| Ga0210399_100597073 | 3300020581 | Soil | MTNSEQKVLWRGVAAGMLVGLATGLMIALFIAIKPDLFAALVR |
| Ga0210395_1000005052 | 3300020582 | Soil | MTNSEEKVLWRGVAAGTLMGLAFGLMIALFIATKPELFAALVR |
| Ga0210395_109228611 | 3300020582 | Soil | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRPDLFRALIP |
| Ga0210406_100574434 | 3300021168 | Soil | MTKGEQKVLARGVAAGTFMGLAIGLILALFIAMKPELFAGLIR |
| Ga0210400_109617391 | 3300021170 | Soil | MTNGEQKMLWRGVTAGTVVGVALGLMIALFVAMKPELLAG |
| Ga0210385_103287462 | 3300021402 | Soil | MTNGEQKMLWRGVTAGTVVGVALGLMIALFVAMKPELLAGLIR |
| Ga0210387_1000298712 | 3300021405 | Soil | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR |
| Ga0210383_103476252 | 3300021407 | Soil | MTNGEQKMLARGVAAGMLMGVAIGFIIALFIEMKPELFAGLIQ |
| Ga0210383_104957272 | 3300021407 | Soil | MTNGEQKVLWRGVVAGTILGLAFGLMIALFIAMKPELFAGLIR |
| Ga0210384_102129712 | 3300021432 | Soil | MTNGEQKMLARGVAAGTILGLAIGLMIALFIAMKPGLFAGLIR |
| Ga0210402_100661123 | 3300021478 | Soil | MTTSEQKVLTRGVAAGTIVGVAVGLMIALFIAIRPDLFRALIP |
| Ga0210409_100103299 | 3300021559 | Soil | MTTSEQKVLVRGVAAGTIVGLAVGLMIALFIAIRPDLFRALIP |
| Ga0126371_110775863 | 3300021560 | Tropical Forest Soil | MTTGEQKVLYRGVAAGTLMGVAIGLMIALVIAMRPELFAALVR |
| Ga0212091_102993081 | 3300022549 | Groundwater | MLTRGVTAGTVLGLAVGLMIALFIALKPALFAGLIQ |
| Ga0224550_10149702 | 3300022873 | Soil | MTKGEQKMLARGVAAGTIIGVAIGLIIALFIRMKPELFAGLIH |
| Ga0247761_11140952 | 3300022878 | Plant Litter | MTTSEQKVLWRGVAAGTMVGLALGGMIALFIAIKPELFSALLR |
| Ga0247778_10035992 | 3300022894 | Plant Litter | MTSGEEKMLWRGVAAGTLMGLAIGGMFALVIAIKPEFLAVLSQ |
| Ga0247778_12208112 | 3300022894 | Plant Litter | MTTGEHKVLVRGVAAGTMVGLALGLMIALFIALRPELFGALIQ |
| Ga0247764_10028104 | 3300022897 | Plant Litter | MTNGEQKVLWRGLAAGTILGLTLGLMVALVIAIKPESFAGLIR |
| Ga0247764_10589732 | 3300022897 | Plant Litter | MTIGEQKVLWRGVAAGTLIGMAIGGMIALVVAMKLELFARLIG |
| Ga0247774_10364002 | 3300022903 | Plant Litter | MTTSEHKVLVRGVAAGTMVGLALGLMIALFIALRPELFGALIQ |
| Ga0247784_100005010 | 3300023270 | Plant Litter | MTNGEQKVLWRGVSAGTLIGMAIGGMIALVIVMKSELFARLIG |
| Ga0247784_11518902 | 3300023270 | Plant Litter | MTNGEQKVLWRGLAAGTIMGLTLGLMVALVIAIKPGLFAGLIR |
| Ga0247763_10726622 | 3300023274 | Plant Litter | MTIGEQKVLWRGVAAGTLIGMAIGGMIALVIVMKSELFARLIG |
| Ga0247691_10483902 | 3300024222 | Soil | TNGEQKVLGRGVAAGTIVGLALGLMVALFIAMKPELFAGLIR |
| Ga0209958_10151682 | 3300024988 | Wastewater Bioreactor | MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG |
| Ga0209952_10243491 | 3300024989 | Wastewater Bioreactor | MTNGEQKMLGRGVAAGMVMGLAIGLMIALFVAMRPEVFAVLVR |
| Ga0208848_10469512 | 3300025509 | Arctic Peat Soil | MTNGEQKVLWRGVAVGTIVGLALGLMIALFIAMKPELFAGLIR |
| Ga0210142_10109912 | 3300025552 | Natural And Restored Wetlands | MTNGEQKMLWRGVAAGTIMGLAIGGLIALVIAMKPELIAGLIQ |
| Ga0207680_104431922 | 3300025903 | Switchgrass Rhizosphere | MTDGEQKALWRGVAAGTMVGLAFGLMIALFIAMKPELFAGLIR |
| Ga0207647_100113964 | 3300025904 | Corn Rhizosphere | MTNSEEKLLKRGVAAGTLVGLAVGGMIALFIAMKPEFFAALVR |
| Ga0207662_106672432 | 3300025918 | Switchgrass Rhizosphere | MTNGEQKMLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGLNL |
| Ga0207681_103622842 | 3300025923 | Switchgrass Rhizosphere | MTNGEQKMLVRGVAAGTLAGLAIGLMIALSVAIRPELFAGLIQ |
| Ga0207650_110004602 | 3300025925 | Switchgrass Rhizosphere | MTNNEQKVLVRGVAAGTIMGVAIGLMLALVIAMKPAFFAGLVHYL |
| Ga0207701_116360762 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSGEQKVLVRGVAAGTIMGVAVGLMLALFIAMKPEFFAGLNL |
| Ga0207704_105237632 | 3300025938 | Miscanthus Rhizosphere | MTNGEKKVLTRGLAAGTILGLAIGLMIALFIAMKPELFAGLIR |
| Ga0207712_114745722 | 3300025961 | Switchgrass Rhizosphere | VPWEIEMTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLMR |
| Ga0207712_118947902 | 3300025961 | Switchgrass Rhizosphere | MTNGEQKMLVRGVAAGTIMGLAIGLILALFIAIKPEFFARLIQ |
| Ga0207668_100717544 | 3300025972 | Switchgrass Rhizosphere | MTNAEEKVLKRGVAAGTLVGLAIGGMIALFIAMRPELFAALIR |
| Ga0207703_114280722 | 3300026035 | Switchgrass Rhizosphere | MTPNERKVLWRGVAAGTLIGLALGLMLALVIAVRPELFAGLMR |
| Ga0207678_116699652 | 3300026067 | Corn Rhizosphere | MTTGEHRMLTREVAAGTIIGLAVGLMIALFIAMKPALFAGLMR |
| Ga0207674_107063472 | 3300026116 | Corn Rhizosphere | MTPGEQKFLYRGVAAGTLIGLALGLMIALAIAVKPEFFAVLLR |
| Ga0207683_103492392 | 3300026121 | Miscanthus Rhizosphere | VLVRGVAAGTILGLAVGLIIALFIAMKPEFFAGLIH |
| Ga0207698_126693401 | 3300026142 | Corn Rhizosphere | MTNSEEKLLKRGVAAGTLVGLAVGGMIALFIAMKPEFFAAL |
| Ga0209222_10667521 | 3300027559 | Forest Soil | MTNGEQKVLWRGVAAGTIVGLALGLLIALFIAMKPALFAGLIQ |
| Ga0209733_10459402 | 3300027591 | Forest Soil | MTNGEQKMLARGVAAGTIMGVAIGLIIALFIEMKPELFAGLIQ |
| Ga0209007_11927232 | 3300027652 | Forest Soil | MLARGVAVGTIIGVAIGLIIALFIRMKPELFAGLIH |
| Ga0209736_11100982 | 3300027660 | Forest Soil | MKNGEQKVLWRGVAAGTIVGVALGLMIALFIAMKPELFAGLVR |
| Ga0209282_12475442 | 3300027666 | Root Nodules | MTNGEQKVLCRGLAAGTLIGVAIGGMIALVIAMKPEVFAGLIR |
| Ga0209248_102065701 | 3300027729 | Bog Forest Soil | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRPELFRALIP |
| Ga0209810_10916783 | 3300027773 | Surface Soil | MTTGEQKTLSRGVAAGVLVGLAIGGIIALFIAMNPTVFSSLVR |
| Ga0209773_101315592 | 3300027829 | Bog Forest Soil | MTTGEQKVLARGVAAGTIVGVAVGLMIALFIAIRPDLFRALIP |
| Ga0209274_101881662 | 3300027853 | Soil | VPVALGECEMTNGEQKVLWRGVAAGTIVGLALGLMIALFIAIKPELFAGLIR |
| Ga0209693_101942142 | 3300027855 | Soil | MTTSEQKVLARGVAAGTIVGVAVGLMIALFIAIRPDLFR |
| Ga0209167_104193002 | 3300027867 | Surface Soil | MTKGEQKVLARGVAAGSIIGLAVGLMLALFIAIRPELFRALIQ |
| Ga0209481_100026543 | 3300027880 | Populus Rhizosphere | MTPGEQKMLNRGVAAGALIGLVIGGLIALFIAMKPEFFAALLH |
| Ga0209481_100187014 | 3300027880 | Populus Rhizosphere | LEARHDNGEQKMLWRGLAAGTLVGLVIGGMIALVIAVKPELFAGLIQ |
| Ga0209486_102300462 | 3300027886 | Agricultural Soil | MTHGEQKFLSRGVAAGTLVGLAIGLMVALFVAMKPHLFAGLFQ |
| Ga0209068_101668762 | 3300027894 | Watersheds | MTQGEQKVLVRGVAAGTLMGLGIGLIIALFIAMKPGLFAGLIHLR |
| Ga0209624_1000155214 | 3300027895 | Forest Soil | MTNGEQKVLWRGVAAGTIVGLGLGLMIALFIAMKAGLFAGLTQ |
| Ga0209048_105852862 | 3300027902 | Freshwater Lake Sediment | MTSGEQKVLVRGVAAGTIMGIAIGLMLALVIAMKPHLFAGLVR |
| Ga0209415_105274762 | 3300027905 | Peatlands Soil | MTNGEQKILARGVAAGTITGLALGLMIALFVAMKAEFFAGFFR |
| Ga0207428_105619151 | 3300027907 | Populus Rhizosphere | MTNGEQKMLWRGVAAGTLIGLAIGGIIALFIAVKPELFAGLIQ |
| Ga0209006_106314352 | 3300027908 | Forest Soil | MTNGEQKVLWRGVAAGTIVGLALGLMTALFIAMKPELFAGLIR |
| Ga0209382_101892905 | 3300027909 | Populus Rhizosphere | MTKGEEKMLFRGVAAGTLIGLVIGGMIALIIAAKPELFAGLIQ |
| Ga0209382_108932941 | 3300027909 | Populus Rhizosphere | MTKGEEKMLFRGVAAGTLIGLVIGGMIALIIAAKPELFAGLIR |
| Ga0209526_109932531 | 3300028047 | Forest Soil | MTNGEQKVFWRGVAAGTMLGLALGLITALFVAMKPELFSGLFNVFP |
| Ga0268265_100023986 | 3300028380 | Switchgrass Rhizosphere | MTTGEQKALNRGVAAGTLIGVAIGLMIALAIMAKPAFFAALIG |
| Ga0268264_116717631 | 3300028381 | Switchgrass Rhizosphere | GRDPTTNPEVEMTNGEQKMAWRGIAAGTIMGLALGLIIALFVAIRPELFAALRF |
| Ga0137415_100365333 | 3300028536 | Vadose Zone Soil | MTNGEQKMLWRGVAAGTLMGIAIGGMIALFIAIKPEFFAGLMQTL |
| (restricted) Ga0255341_10868731 | 3300028570 | Wastewater | MTSGERKMLVRGVAAGTIMGVAIGLIIALFIVIKPEFFAALIR |
| Ga0302153_100859472 | 3300028574 | Bog | MTNGEQKVLWRGVAAGTIVGLALGLMIALFISIKPELFAGLIR |
| Ga0302301_10821461 | 3300028731 | Palsa | MTQGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPELFAGLIR |
| Ga0302219_100077756 | 3300028747 | Palsa | MTQGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPA |
| Ga0302219_100998271 | 3300028747 | Palsa | YPRRCEMTQGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPELFAGLIR |
| Ga0302219_102059702 | 3300028747 | Palsa | MTNGEVKMLWRGVAAGTIMGLALGLMTALFIAMYPGLFAGLVRN |
| Ga0302156_100581553 | 3300028748 | Bog | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAIKPELFAGLIR |
| Ga0302225_105676391 | 3300028780 | Palsa | VTNGEQKMLQRGVAAGTILGLAIGLLMALFIQMKPELFAGLIK |
| Ga0302279_100566563 | 3300028783 | Bog | MTSGEHKVLVRGVAAGTIMGMAIGLMIAMLIAMRPGLLAGLIQ |
| Ga0307517_103294551 | 3300028786 | Ectomycorrhiza | MTNGEQKMLWRGVAAGTITGLAMGLIAALFIALKPEFFAALIR |
| Ga0302227_101305511 | 3300028795 | Palsa | RCEMTQGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPAGLIR |
| Ga0302222_101134912 | 3300028798 | Palsa | MTQGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPAGLIR |
| Ga0307503_102712101 | 3300028802 | Soil | MTNGEKKVLARGLAAGTILGLAVGVIIALFIAMKPELFAGLIR |
| Ga0307312_108356731 | 3300028828 | Soil | FQCLWEVEMTTSEKKMLAAGTIMGLVVGLMIALFIAIRPELFRALTP |
| Ga0311362_107202032 | 3300029913 | Bog | PKVLWRGVAAGTIVALALGLMIALFIAMKPELFEGLIL |
| Ga0311371_115855452 | 3300029951 | Palsa | MTNGEQQVLWRGVAAGTIVGLALGLMLALSIATKPALFAGPLR |
| Ga0311343_112906481 | 3300029953 | Bog | CEMTNGEQKVLWRGVAAGTIVGLALGLMIALFIAIKPELFAGLIR |
| Ga0302150_101319351 | 3300029956 | Bog | MTNGEQKVRAVAAGTIVGLALGLMIALFIAIKPELFAGLIR |
| Ga0302150_102310442 | 3300029956 | Bog | APKVLWRGVAAGTIVALALGLMIALFIAMKPELFEGLIL |
| Ga0302276_102456802 | 3300029992 | Bog | MTNGEQKVLWRGVAAGTIVGLALGLMIALFIAIKPELFA |
| Ga0302178_103404462 | 3300030013 | Palsa | EMTNGEVKMLWRGVAAGTIMGLALGLMTALFIAMYPGLFAGLVRN |
| Ga0302300_11265102 | 3300030042 | Palsa | MTNGEQRVLWRGVAAGTIVGLALGLMIALLIAMKPELSAGLIR |
| Ga0302179_100464901 | 3300030058 | Palsa | PWRCEMTNGEVKMLWRGVAAGTIMGLALGLMTALFIAMYPGLFAGLVRN |
| Ga0302183_100400304 | 3300030509 | Palsa | MTNGEAKMLWRGVAAGTIMGLALGLMTALFIAMYPGLFAGLVRN |
| Ga0311372_103808511 | 3300030520 | Palsa | NGEQKVLWRGVAAGTIVGLALGLMVGLFVAMKPELFAGLIR |
| Ga0311372_110887393 | 3300030520 | Palsa | MTDGEQKVLWRGVAAGTIVGLALGLMIALFIAMKPALFAGLIH |
| Ga0311372_121133011 | 3300030520 | Palsa | EQQVLWRGVAAGTIVGLALGLMLALSIATKPALFAGPLR |
| Ga0210272_13116721 | 3300030573 | Soil | HGESEMTNSEQKVLVRGVTAGTILGLAIGLMIALFIAVRPELFAALIR |
| Ga0265462_112054523 | 3300030738 | Soil | VAHGESEMTNSEQKVLVRGVTAGTILGLAIGLMIALFIAVRPELFAALIR |
| Ga0265763_10199461 | 3300030763 | Soil | MTNSEQKVLVRGVTAGTILGLAIGLMIALFIAVRPELFAALIR |
| Ga0307497_100505812 | 3300031226 | Soil | MKFLSRGVAAGTLVGVAIGLIIALFVAMKPHLFAGLIQ |
| Ga0307497_103008282 | 3300031226 | Soil | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPEFFAGLIQ |
| Ga0299913_100802472 | 3300031229 | Soil | MTKGEQKMLVRGVAAGTIIGLAIGLMIALFIAMKPELFAGLIQ |
| Ga0170824_1167430394 | 3300031231 | Forest Soil | MTKGEQKMLWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR |
| Ga0302323_1010891992 | 3300031232 | Fen | MTTGEQKMLVRGVSAGVLMGVAIGLMLALFIALRPELFAALIR |
| Ga0302325_120414071 | 3300031234 | Palsa | PWRCEMTNGEQKVLWRGVAAGTIAGLALGLMIALFIAVKPELLARLIR |
| Ga0302324_1002160215 | 3300031236 | Palsa | MTNSEQKVLWRGVAAGTIVGLALGLMIALFIAMKPERFAGLIQ |
| Ga0307506_101620471 | 3300031366 | Soil | MTNSEQKVLVRGVAAGTITGVAIGLMLALVVAMKPEFFAGLVHYL |
| Ga0307505_100543072 | 3300031455 | Soil | MTNGEQKMFWGGVTGGTLMGLAIGGMIAMVIAMKPELFAGLIQ |
| Ga0307505_102103661 | 3300031455 | Soil | MTSGEQKVLTRGVAAGALMGVAIGLMIALVIAMKPDFFAALLR |
| Ga0307513_100144552 | 3300031456 | Ectomycorrhiza | MTHDEKKYLSRGVAAGTLMGLAIGLIIALFVAMKPHLFAGLIQ |
| Ga0307509_1000146326 | 3300031507 | Ectomycorrhiza | MTNGEQKMLRRGVAAGSLMGLAIGGIIALVIAMKPELFAGLIP |
| Ga0310887_101344732 | 3300031547 | Soil | MTNAEQKVLVRGVTAGTIMGLAIGLMLALFIAMKPEFFAGLIQ |
| Ga0307408_1000189714 | 3300031548 | Rhizosphere | MTHGEQKMLWRGVAAGTIIGMAIGGMIALVIAMKPELFAALI |
| Ga0310686_1019494773 | 3300031708 | Soil | MTNSEQKVLWRGVAAGTIVGLALGLMISLFIAMKPELFAGLIR |
| Ga0310686_1098683732 | 3300031708 | Soil | MTNDEQKMLWRGVAAGKIVGLVQALGLRIALFIAMKPELFAGLIR |
| Ga0310686_1126690781 | 3300031708 | Soil | MVLSAHGESEMTNSEQKVLVRGVTAGTILGLAIGLMIALFIAVRPELFAALIR |
| Ga0310686_1144115808 | 3300031708 | Soil | MTNGEQRALWRGVAAGTIVGLALGLMIALFIAMKPELFAGLIR |
| Ga0307413_112455291 | 3300031824 | Rhizosphere | MTKGEQKMLWRGVAAGTLMGLVIGGMIALCIAARPEFFAGLIQ |
| Ga0310892_103312382 | 3300031858 | Soil | NFWRSEMTPGEQKMLNRGVAAGALIGLVIGGLIALFIAMKPEFFAALLH |
| Ga0307406_103332332 | 3300031901 | Rhizosphere | MTNREPKVLTRGVAAGTMIGLAIGGIIALFIQMKAEFFAALIQ |
| Ga0307407_104742672 | 3300031903 | Rhizosphere | MTKGEQRVLMRGVAAGTMIGLAIGLMIALFIAMKPELFAGLFQ |
| Ga0307407_114846722 | 3300031903 | Rhizosphere | MTQGEQKMLWRGVAAGTIIGMAIGGMIALVIAMKPELFAALI |
| Ga0310900_104665641 | 3300031908 | Soil | MTNGEQKVLVRGVAAGTIVGVAIGLMLALFIAMKPELFAGLIQ |
| Ga0310900_106470862 | 3300031908 | Soil | MTLGEQKMLNRGVAAGTLIGLVMGGLIALFIAMKPEFFAALLH |
| Ga0310884_101246153 | 3300031944 | Soil | VEVEVTPNEQKVLWRGVAAGTLIGLALGLMIALVIAVRPELFRALMQ |
| Ga0307479_102619673 | 3300031962 | Hardwood Forest Soil | CEMTKGEQKVLVRGVAAGTMLGLAIGLMVALFIAIKPELFAALIQH |
| Ga0307409_1008598822 | 3300031995 | Rhizosphere | MTKSEQRLLMRGVAAGTMIGLAIGLMIALFIAMKP |
| Ga0307416_1033799032 | 3300032002 | Rhizosphere | MTSGEQKVLMRGVAAGCLMGLALGGMIALFIALRPELLARLIQ |
| Ga0307414_114406372 | 3300032004 | Rhizosphere | MTNGEQKMLVRGVAAGTLIGLVIGGMIALCIAMKPELLAGLI |
| Ga0307414_118337202 | 3300032004 | Rhizosphere | MTGGEQKMLWRGVAAGTLIGLAIGGMIALVVAVRPELFAGLIQ |
| Ga0307411_101263342 | 3300032005 | Rhizosphere | MTNREQKVLTRGVAAGTMIGLAIGGIIALFIQMKAEFFAALIQ |
| Ga0310902_101744182 | 3300032012 | Soil | MTNGEQKMLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGL |
| Ga0310902_103353912 | 3300032012 | Soil | MTPGEQKFLYRGVAAGTLIGLALGLMIALAIAVKPEFFAAVLR |
| Ga0310906_106883782 | 3300032013 | Soil | MTNGEQKVLVRGVAAGTIMGLAIGLMLALFIAMKPEFFPGLIR |
| Ga0308173_104514171 | 3300032074 | Soil | MTSGHQKSLTRGVAAGTLMGLAIGAIIALFVAMKPEFFAVLFRYL |
| Ga0308173_115988041 | 3300032074 | Soil | MTNGEQKVLARGVAAGTVMGLAIGGLIALFIAMKPDLLARLLQ |
| Ga0307415_1025739851 | 3300032126 | Rhizosphere | MKNGEQKLMMRGVTAGTLIGLALGGIIALFIALRPDLLARLME |
| Ga0315910_103798082 | 3300032144 | Soil | MTNGEHKMLLRGVAGGTLMGMVLGLMLALVIALKPEFFAGLSRYL |
| Ga0315912_100198602 | 3300032157 | Soil | VTNGEQKMLRRGVAAGTLMGMAIGGLIALFIAVWPVFLAALVQ |
| Ga0335074_110190951 | 3300032895 | Soil | KVLWRGVAAGTIVGLALGLMIALVIAMRPEAFSALMH |
| Ga0335077_1000257410 | 3300033158 | Soil | MTNRERKILWRGVAAGTIVGLALGLIIALFIAMKPELLAGPIQ |
| Ga0214472_107586743 | 3300033407 | Soil | VEFKHVVHHAALVRGVAAGTIMGVAIGLMLALFIAMKPEFFAGLIQ |
| Ga0310810_110592172 | 3300033412 | Soil | MTPNERKVLRRGVAAGTLVGLALGLMLALVIAIRPELF |
| Ga0214471_100978523 | 3300033417 | Soil | MTNGEQKVLWRGVAAGTILGLAIGGMIALVIAMKPELFAGLIQ |
| Ga0247830_107999461 | 3300033551 | Soil | LESKMTDREQKVLWRGVAAGMLTGVAIGLIIALFIAMKPELFVWLAR |
| Ga0364945_0012284_1282_1410 | 3300034115 | Sediment | MTNGEQKMLFRGVAAGTLMGVAIGLMLALVIAMKPEFFAGLN |
| Ga0370493_0339011_250_381 | 3300034129 | Untreated Peat Soil | MTNGEQKVLWRGVAAGTMVGFALGLMIALFIAIKPELFAGLSR |
| Ga0364925_0170108_298_429 | 3300034147 | Sediment | MTLGEKKMLWRGVAAGTIMGLAMGGIIALFIAMKPELFAGLFQ |
| Ga0370514_157537_463_573 | 3300034199 | Untreated Peat Soil | MLTRGVAAGTIMGVAIGLIIALFIAMKPELFAGLIR |
| Ga0314793_031111_163_294 | 3300034668 | Soil | MTNGEQKMLVRGVAGGTIMGVAIGLMLALVIAMKPEFFAGLIQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |