


| Basic Information | |
|---|---|
| Family ID | F084884 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLA |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.38 % |
| % of genes near scaffold ends (potentially truncated) | 85.71 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.393 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat (16.071 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.643 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (30.357 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF14106 | DUF4279 | 2.68 |
| PF13470 | PIN_3 | 1.79 |
| PF04471 | Mrr_cat | 1.79 |
| PF12158 | DUF3592 | 1.79 |
| PF05015 | HigB-like_toxin | 1.79 |
| PF02371 | Transposase_20 | 1.79 |
| PF03683 | UPF0175 | 1.79 |
| PF12838 | Fer4_7 | 0.89 |
| PF13240 | zinc_ribbon_2 | 0.89 |
| PF07927 | HicA_toxin | 0.89 |
| PF12867 | DinB_2 | 0.89 |
| PF09685 | DUF4870 | 0.89 |
| PF00072 | Response_reg | 0.89 |
| PF13847 | Methyltransf_31 | 0.89 |
| PF13651 | EcoRI_methylase | 0.89 |
| PF14076 | DUF4258 | 0.89 |
| PF04167 | DUF402 | 0.89 |
| PF16472 | DUF5050 | 0.89 |
| PF00805 | Pentapeptide | 0.89 |
| PF14319 | Zn_Tnp_IS91 | 0.89 |
| PF13302 | Acetyltransf_3 | 0.89 |
| PF13604 | AAA_30 | 0.89 |
| PF04191 | PEMT | 0.89 |
| PF08388 | GIIM | 0.89 |
| PF08327 | AHSA1 | 0.89 |
| PF12724 | Flavodoxin_5 | 0.89 |
| PF01337 | Barstar | 0.89 |
| PF09945 | DUF2177 | 0.89 |
| PF10881 | DUF2726 | 0.89 |
| PF13391 | HNH_2 | 0.89 |
| PF13546 | DDE_5 | 0.89 |
| PF00075 | RNase_H | 0.89 |
| PF08002 | DUF1697 | 0.89 |
| PF02517 | Rce1-like | 0.89 |
| PF00990 | GGDEF | 0.89 |
| PF01965 | DJ-1_PfpI | 0.89 |
| PF01208 | URO-D | 0.89 |
| PF03100 | CcmE | 0.89 |
| PF13508 | Acetyltransf_7 | 0.89 |
| PF11848 | DUF3368 | 0.89 |
| PF01872 | RibD_C | 0.89 |
| PF01839 | FG-GAP | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.79 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.79 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 1.79 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.89 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.89 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.89 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.89 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.89 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG2732 | Barstar, RNAse (barnase) inhibitor | Transcription [K] | 0.89 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.89 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.29 % |
| Unclassified | root | N/A | 10.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000230|TB_GS10_10DRAFT_10056066 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1003307 | All Organisms → cellular organisms → Bacteria | 7461 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1005965 | All Organisms → cellular organisms → Bacteria | 5217 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1043859 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1084 | Open in IMG/M |
| 3300000236|TB_FS08_3DRAFT_1031398 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300000236|TB_FS08_3DRAFT_1061972 | Not Available | 515 | Open in IMG/M |
| 3300001373|YBMDRAFT_10150236 | Not Available | 572 | Open in IMG/M |
| 3300002024|MIS_1057930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa | 1267 | Open in IMG/M |
| 3300002024|MIS_1143659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Acetobacterium → Acetobacterium bakii | 1045 | Open in IMG/M |
| 3300002024|MIS_1152027 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1028 | Open in IMG/M |
| 3300002024|MIS_1166329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1001 | Open in IMG/M |
| 3300002027|MIS_10094511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 2111 | Open in IMG/M |
| 3300002027|MIS_10160719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1621 | Open in IMG/M |
| 3300002027|MIS_10172925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → environmental samples → uncultured Desulfobacteraceae bacterium | 1559 | Open in IMG/M |
| 3300004209|Ga0066649_10232837 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 985 | Open in IMG/M |
| 3300004779|Ga0062380_10497360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 541 | Open in IMG/M |
| 3300005077|Ga0071116_1037095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3280 | Open in IMG/M |
| 3300005077|Ga0071116_1119828 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300005077|Ga0071116_1265537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 512 | Open in IMG/M |
| 3300005830|Ga0074473_10356954 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 513 | Open in IMG/M |
| 3300005831|Ga0074471_10655869 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300005831|Ga0074471_10655988 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005895|Ga0075277_1004995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 1631 | Open in IMG/M |
| 3300005900|Ga0075272_1064364 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 685 | Open in IMG/M |
| 3300005904|Ga0075280_10005098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 1974 | Open in IMG/M |
| 3300005982|Ga0075156_10443377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300009009|Ga0105105_10207587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1018 | Open in IMG/M |
| 3300009009|Ga0105105_10275057 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009009|Ga0105105_10276341 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300009009|Ga0105105_10581146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 652 | Open in IMG/M |
| 3300009032|Ga0105048_11308352 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 582 | Open in IMG/M |
| 3300009146|Ga0105091_10125909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. MQZ13P-5 | 1190 | Open in IMG/M |
| 3300009167|Ga0113563_11007230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 959 | Open in IMG/M |
| 3300009179|Ga0115028_10278936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1110 | Open in IMG/M |
| 3300009509|Ga0123573_12171386 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300011391|Ga0137331_1041372 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300011408|Ga0137460_1027391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 954 | Open in IMG/M |
| 3300011427|Ga0137448_1148822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 650 | Open in IMG/M |
| 3300012044|Ga0136636_10246749 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 790 | Open in IMG/M |
| 3300012533|Ga0138256_10486993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1000 | Open in IMG/M |
| 3300012533|Ga0138256_10647582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 832 | Open in IMG/M |
| 3300012533|Ga0138256_10884730 | Not Available | 681 | Open in IMG/M |
| 3300012533|Ga0138256_10940755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300013092|Ga0163199_1404683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10003296 | All Organisms → cellular organisms → Bacteria | 21112 | Open in IMG/M |
| 3300014258|Ga0075315_1001850 | Not Available | 2216 | Open in IMG/M |
| 3300014261|Ga0075360_1113238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300014502|Ga0182021_11246526 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300014877|Ga0180074_1026763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_47_9 | 1151 | Open in IMG/M |
| 3300015259|Ga0180085_1099944 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300018059|Ga0184615_10477639 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300020048|Ga0207193_1420344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium chlorochromatii | 890 | Open in IMG/M |
| 3300020198|Ga0194120_10042741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3769 | Open in IMG/M |
| 3300021081|Ga0210379_10278287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 729 | Open in IMG/M |
| 3300021090|Ga0210377_10174500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1386 | Open in IMG/M |
| 3300021090|Ga0210377_10392680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 826 | Open in IMG/M |
| 3300021090|Ga0210377_10514053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 689 | Open in IMG/M |
| 3300021351|Ga0210365_10676185 | Not Available | 898 | Open in IMG/M |
| 3300022208|Ga0224495_10050025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1903 | Open in IMG/M |
| 3300025327|Ga0209751_10843843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 709 | Open in IMG/M |
| 3300026026|Ga0210129_1035680 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300027726|Ga0209285_10140039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-3 | 748 | Open in IMG/M |
| 3300027739|Ga0209575_10032025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1893 | Open in IMG/M |
| 3300027762|Ga0209288_10063425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1123 | Open in IMG/M |
| 3300028178|Ga0265593_1062021 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300028283|Ga0268283_1124651 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 732 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1333351 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 504 | Open in IMG/M |
| 3300028646|Ga0302159_10066242 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300028647|Ga0272412_1156288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 959 | Open in IMG/M |
| 3300028804|Ga0268298_10121854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1518 | Open in IMG/M |
| 3300028916|Ga0310376_1035564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1081 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10665137 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 513 | Open in IMG/M |
| 3300029981|Ga0302293_10279658 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 510 | Open in IMG/M |
| 3300030019|Ga0311348_10352517 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium | 1098 | Open in IMG/M |
| 3300030019|Ga0311348_10641988 | Not Available | 792 | Open in IMG/M |
| 3300030685|Ga0302285_10278909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-5 | 512 | Open in IMG/M |
| 3300030838|Ga0311335_10800494 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031232|Ga0302323_100482746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1326 | Open in IMG/M |
| 3300031256|Ga0315556_1073846 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1350 | Open in IMG/M |
| 3300031726|Ga0302321_100046347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 4180 | Open in IMG/M |
| 3300031726|Ga0302321_102457173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 608 | Open in IMG/M |
| 3300031726|Ga0302321_102743868 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 575 | Open in IMG/M |
| 3300031902|Ga0302322_100818979 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300032173|Ga0315268_10000066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 113360 | Open in IMG/M |
| 3300033420|Ga0316608_1074232 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 957 | Open in IMG/M |
| 3300033420|Ga0316608_1074624 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300033420|Ga0316608_1096697 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 807 | Open in IMG/M |
| 3300033446|Ga0316611_1020407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1987 | Open in IMG/M |
| 3300033446|Ga0316611_1062399 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300033446|Ga0316611_1063187 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300033446|Ga0316611_1067314 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300033446|Ga0316611_1085373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 792 | Open in IMG/M |
| 3300033446|Ga0316611_1086586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 784 | Open in IMG/M |
| 3300033446|Ga0316611_1111554 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300033488|Ga0316621_10775725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_13_50_21 | 699 | Open in IMG/M |
| 3300033488|Ga0316621_11320568 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 549 | Open in IMG/M |
| 3300033494|Ga0316612_1091862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 680 | Open in IMG/M |
| 3300033498|Ga0316610_1024056 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1498 | Open in IMG/M |
| 3300033498|Ga0316610_1032357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa | 1279 | Open in IMG/M |
| 3300033498|Ga0316610_1050843 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300033498|Ga0316610_1074995 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 777 | Open in IMG/M |
| 3300033498|Ga0316610_1075252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
| 3300033498|Ga0316610_1114906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. | 592 | Open in IMG/M |
| 3300033521|Ga0316616_101471678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 881 | Open in IMG/M |
| 3300034156|Ga0370502_0059669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1203 | Open in IMG/M |
| 3300034194|Ga0370499_0120787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat | 16.07% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.25% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 6.25% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 5.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.46% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.46% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.57% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 3.57% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 2.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.68% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 2.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.79% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.79% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.79% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.79% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.89% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.89% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.89% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.89% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.89% |
| Anaerobic Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300000233 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10 | Environmental | Open in IMG/M |
| 3300000236 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3 | Environmental | Open in IMG/M |
| 3300001373 | YB-Mouth-sed | Environmental | Open in IMG/M |
| 3300002024 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004209 | Groundwater microbial communities from aquifer - Crystal Geyser CG22_combo_CG10-13_8/21/14_all | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300011391 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021351 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026026 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300028916 | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998 | Engineered | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030685 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033420 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.152B | Environmental | Open in IMG/M |
| 3300033446 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202 | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033494 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.226 | Environmental | Open in IMG/M |
| 3300033498 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_GS10_10DRAFT_100560662 | 3300000230 | Groundwater | VHPTLGILARFQAFFYASAFFQLDGVPPPTPARVTQTVGTLLDVIGIQ |
| TB_FS06_10DRAFT_100330714 | 3300000233 | Groundwater | MHPTLGSLARFQAFFYASAFFQSDGVPPPDPARVTQTVGRLNT* |
| TB_FS06_10DRAFT_10059657 | 3300000233 | Groundwater | QSVHPTLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVGTPLA* |
| TB_FS06_10DRAFT_10438591 | 3300000233 | Groundwater | QSVHPTLGILARFQAFFYASAFFQSDGVPPPAPAQVTQTVGRFRAKHTK* |
| TB_FS08_3DRAFT_10313981 | 3300000236 | Groundwater | QSVHPTLGILARFQAFFYASAFSQSDGVPPPDPARVTQTIGTTRA* |
| TB_FS08_3DRAFT_10619722 | 3300000236 | Groundwater | PALGILARFKAFFYASAFFQSDGVPPPAPARVTQTVGTTLAKLKFQ* |
| YBMDRAFT_101502361 | 3300001373 | Marine Estuarine | QNAQQSVHPTLGILARFQAFFYASAFFQSDGVPPPDPARVTQTVGR* |
| MIS_10579301 | 3300002024 | Sinkhole Freshwater | RFQAFFYASAFFQSDGVPPPAPARVTQTVGTPLAQQGK* |
| MIS_11436591 | 3300002024 | Sinkhole Freshwater | SVHPTLGILARFQAFSYASAFSQSDGVPPPDPARVTQTVGTPLA* |
| MIS_11520271 | 3300002024 | Sinkhole Freshwater | TLGILARFQAFFYASAFSQLDGVPPPNPARVTQTVGTPLA* |
| MIS_11663291 | 3300002024 | Sinkhole Freshwater | FQAFFYASAFFQSDGVPPPAPARVTQTVSHPLPYQG* |
| MIS_100945111 | 3300002027 | Sinkhole Freshwater | QQSVHPTLGIRRHFQAFSYASTFFQSDGVPPPAPARVTQTVSRFV* |
| MIS_101607191 | 3300002027 | Sinkhole Freshwater | QSVHPTLGILARFQAFFYTSAFSQSDGVPPPDPARVTQTVGRWRMQQNLFENL* |
| MIS_101729251 | 3300002027 | Sinkhole Freshwater | QSVHPTLGIRRHFQAFFYASAFSQSDGVPPPAPARVTQTVGRLVSKG* |
| Ga0055440_101540462 | 3300004020 | Natural And Restored Wetlands | LGILRKSQAVFYAFSFFQSDGFAVPAPAQVTQTGRHLRVTQIP* |
| Ga0066649_102328371 | 3300004209 | Groundwater | PTLGILARFQAFFYASAFSQSDGDPPPAPARVTQTVIGA* |
| Ga0062380_104973602 | 3300004779 | Wetland Sediment | PTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVSPILSVDA* |
| Ga0071116_10370953 | 3300005077 | Sinkhole | MRRKINFFTTASQQSVHLTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGWLIVIQ |
| Ga0071116_11198282 | 3300005077 | Sinkhole | VHPTLGILARFQAFFYALSFFQSDGVPPPAPARVTQTVGRWRYEGQKLK* |
| Ga0071116_12655372 | 3300005077 | Sinkhole | KACQQSVHPTLGSLARFQAFFYASAFFQLDGVPPPAPARVTQTVGRFLAQPK* |
| Ga0074473_103569542 | 3300005830 | Sediment (Intertidal) | LIAKVAAQHSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVR |
| Ga0074471_106558695 | 3300005831 | Sediment (Intertidal) | VHPTLGILARFQAFFYASAFFQSDGVPPPTPARVTQTVGRYVRNE* |
| Ga0074471_106559882 | 3300005831 | Sediment (Intertidal) | VHPTLGILARFQAFFYASAFFQSDGVPPPTPARVTQTVGQFLANNEV* |
| Ga0075277_10049952 | 3300005895 | Rice Paddy Soil | VHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTV |
| Ga0075272_10643642 | 3300005900 | Rice Paddy Soil | AQQSVHPTLGSLATFQAVFYAFSFSQSDGFAVPAPARVTQTVGR* |
| Ga0075280_100050981 | 3300005904 | Rice Paddy Soil | VHPTLGSLRDLQAFFYASAFSQSDGVPPPAPARVTQTVGRWR |
| Ga0075156_104433771 | 3300005982 | Wastewater Effluent | HPTLGILARFQAFFYASAFFQSDGVPSPAPARVTQTVSRLS* |
| Ga0105105_102075871 | 3300009009 | Freshwater Sediment | SVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVSPPFEKQVSDKKW* |
| Ga0105105_102750571 | 3300009009 | Freshwater Sediment | LARFQAFFYTSAFFQSDGVPPPAPARVTQTVGWLVINREK* |
| Ga0105105_102763411 | 3300009009 | Freshwater Sediment | QSVHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQSVGLLAQI* |
| Ga0105105_105811463 | 3300009009 | Freshwater Sediment | MLGSLARFQAFFYALSFFQSDGVPPPAPARVTQTVSLPLA* |
| Ga0105048_113083521 | 3300009032 | Freshwater | LRSKKPTQVTTAQQSVHPTLGILRGLQAFFYASVFFRSDGAPPPAPARVTQTVGQF |
| Ga0105091_101259091 | 3300009146 | Freshwater Sediment | MFSAAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTV |
| Ga0113563_110072303 | 3300009167 | Freshwater Wetlands | ILARFQAFFYASAFSQSDGVPPPAPAQVTQTVGRFTAKHNHDS* |
| Ga0115028_102789362 | 3300009179 | Wetland | NKTAAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVSRLSKIEMK* |
| Ga0123573_121713862 | 3300009509 | Mangrove Sediment | MAAQHRVHPTLGIRSVLQALSNALAFSNADGVPPPAPAQVTQTV |
| Ga0137331_10413721 | 3300011391 | Soil | VHPTLGSLARFQAFFYASAFSQSDGVPPPDPARVTQTVGWQVKE |
| Ga0137460_10273913 | 3300011408 | Soil | PTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVGKNLA* |
| Ga0137448_11488221 | 3300011427 | Soil | SYPKTATQQSVHPTLGILRQSQAFFHASAFSQSDGVPPPDPARVTPTVSHLAEN* |
| Ga0136636_102467491 | 3300012044 | Polar Desert Sand | LGSLATSQAFFYALSFFRSDGVPPPAPARVTQTVGQFIGE* |
| Ga0138256_104869931 | 3300012533 | Active Sludge | VHPTLGILAKSQAFFYALSFFQSDGVPPPDPARVTQTVGRLEKEEDYH |
| Ga0138256_106475822 | 3300012533 | Active Sludge | VHPTLGILARFQAFFYASAFFQSDGIPPPAPARVTQTVSHLPCKNNYE* |
| Ga0138256_108847301 | 3300012533 | Active Sludge | ILARFQAFFYASAFFQSDGVPPPAPARVTQTVGRLSDRIMK* |
| Ga0138256_109407551 | 3300012533 | Active Sludge | QSMHLTLGILRQSQAVFYASSFFQLDGFAVPTPARVTQTVGRLTQLD* |
| Ga0163199_14046831 | 3300013092 | Freshwater | QQSMHPTLGSLARFQAFFYASAFFQSDGVPPPDPARVTQTVGQFLEK* |
| (restricted) Ga0172367_1000329619 | 3300013126 | Freshwater | MTLHTAEQSAHPTLGILAQFQAFFQSDGVPPPAPARVMQAISQPATIETI* |
| (restricted) Ga0172373_103174651 | 3300013131 | Freshwater | MSLLLPQKSGWQKRAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPDPARVTQTV |
| Ga0075315_10018502 | 3300014258 | Natural And Restored Wetlands | QQSVHPTLGSLARFQAFFYASAFFQSDGVPPPAPARVTQTVGRVS* |
| Ga0075360_11132382 | 3300014261 | Natural And Restored Wetlands | VHPTLGSLARFQAVFYALSFFQLDGFAVPAPARVTQTVG |
| Ga0182021_112465261 | 3300014502 | Fen | MHPTLGILARFQAFSYASAFFQSDGVPPPAPARVTQTV |
| Ga0180074_10267631 | 3300014877 | Soil | MKAAQQSVQWICGILPHFQAFFYASAFSQSDGVPPPAPARVTQTVGQIDR* |
| Ga0180085_10999442 | 3300015259 | Soil | VHLTPGSLRRFQAFFYASAFFQLDGFAVPAPAQVRQTVGRL* |
| Ga0184615_104776391 | 3300018059 | Groundwater Sediment | EYTPQNAAQQSVHPTLGILARFQAFLYASAFFQLGGVPPPNPARVTQTVGQFQECK |
| Ga0207193_14203443 | 3300020048 | Freshwater Lake Sediment | PTLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVGTPLAQ |
| Ga0194120_100427413 | 3300020198 | Freshwater Lake | VHPTLGILARFQAFFYASAFFQSDGVPPPAPAQVTQTVGTPLAQQGKKH |
| Ga0210379_102782872 | 3300021081 | Groundwater Sediment | TTAAQQSVHPTLGILARFQAFFYASEFFQSDGVPPPTPARVTQTVSRLLHN |
| Ga0210377_101745003 | 3300021090 | Groundwater Sediment | QQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVSWQIHSL |
| Ga0210377_103926801 | 3300021090 | Groundwater Sediment | LARFQAFFYASAFSQLDGVPPPAPARVTQTVGQFKTITAIKV |
| Ga0210377_105140531 | 3300021090 | Groundwater Sediment | LASLVVIGFAQQSVHPTLGILARFQAFFYASAFFQLDGVPPPAPARVTQTVGL |
| Ga0210365_106761852 | 3300021351 | Estuarine | VHPTLGILARFQAFFYALSFSQSDGGTPSAPARLTHTVSPQPRRLLW |
| Ga0224495_100500254 | 3300022208 | Sediment | ACQQSVHPTLGILARFQAFFYASAFFQSDSVPPPTPARVTQTVRRVRQIVLL |
| Ga0209751_108438432 | 3300025327 | Soil | QSVHPTLGILRHFQAFSYTSAFFQSDGVPPPTPARVTQTVGQLEKL |
| Ga0210129_10356801 | 3300026026 | Natural And Restored Wetlands | VKQKASQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRLSSVHSA |
| Ga0209285_101400391 | 3300027726 | Freshwater Sediment | LGILARFQAFFYASAFSQLDGFAVPAPARVTQTVRRVMVQ |
| Ga0209575_100320252 | 3300027739 | Freshwater | MHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQAVGLLS |
| Ga0209288_100634251 | 3300027762 | Freshwater Sediment | ILARFQAFFYASAFSQSDGVPPPAPARVTQTVGQQTFE |
| Ga0208980_103205482 | 3300027887 | Wetland | VHPTLGILARFQAFFYASAFSQSDGFAVPAPARVTQTVSPFFANIEIEGKKSYAE |
| Ga0209536_1003033781 | 3300027917 | Marine Sediment | GILRRFQAFFYASAFSQLDGFAVPAPAQVTQAVRQLIWMRYG |
| Ga0265593_10620211 | 3300028178 | Saline Water | QSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRLSSME |
| Ga0268283_11246512 | 3300028283 | Saline Water | QNRLAKTAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVSRLS |
| (restricted) Ga0247844_13333511 | 3300028571 | Freshwater | AQQSVHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVRWLSQ |
| Ga0302159_100662421 | 3300028646 | Fen | PTLGSLARFQAFFHAFSFSQSDGVPPPAPARVTQTVGTPLAK |
| Ga0272412_11562881 | 3300028647 | Activated Sludge | QQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGKNLR |
| Ga0268298_101218541 | 3300028804 | Activated Sludge | VKNNAAQQSVHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTV |
| Ga0268298_103160583 | 3300028804 | Activated Sludge | LGILRKPQAVSHAFSFFWLDGFAVPAPAQVTQTVRRLSSRVL |
| Ga0310376_10355641 | 3300028916 | Anaerobic Enrichment Culture | AQQSVHPTLGILARFQAFFYTSAFSQSDGVPPPAPARVTQTVSPLFA |
| (restricted) Ga0247842_106651372 | 3300029268 | Freshwater | VHPTLGILARFQAFFYALSFSQSDGIPPPAPARVTQTVGWLSKNINKGLFDE |
| Ga0302293_102796582 | 3300029981 | Fen | TPMRININAAEQSVHPTLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVGRLS |
| Ga0311348_103525173 | 3300030019 | Fen | LFKPAAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGQSNQ |
| Ga0311348_106419882 | 3300030019 | Fen | LGILARFQAFFYASAFFQLDGVPPPAPARVTQTVERTPVLIAN |
| Ga0302285_102789091 | 3300030685 | Fen | LARFQAFFYTSAFFQSDGVPPPAPARVTQTVGQFLAKQ |
| Ga0311335_108004941 | 3300030838 | Fen | QNCAQQSVHPTLGILCKSQAVFYASAFFQLDGVLPPNPARVTQTVETVE |
| Ga0302323_1004827463 | 3300031232 | Fen | QSVHPTLGILRHFQAVSYALSFFKSDGVPPSAPARVTQTVGWQFKSNQVPK |
| Ga0315556_10738461 | 3300031256 | Salt Marsh Sediment | MIKTAQQSVHPTLGILARFQAFFHASAFSQSDGVPPPAPARVTQTVGRTAE |
| Ga0302321_1000463471 | 3300031726 | Fen | QQSVHPTLGILARFQAFFYASSFFQSDGVPPPAPARVTQTVSPRVYKRITNK |
| Ga0302321_1024571732 | 3300031726 | Fen | AAQQSVHPTLGILARFQAFFYASAFFQSDGFAVPAPARVTQTVRRFLVN |
| Ga0302321_1027438681 | 3300031726 | Fen | QQSVHWTLGILPHFQAFFYASAFSQSDGVPPPAPAPVTQTVSPLQQ |
| Ga0302322_1008189791 | 3300031902 | Fen | HPTLGILARFQAVFYASAFSRSDGVPPPAPARVTQTVGTPLAK |
| Ga0315268_10000066110 | 3300032173 | Sediment | MMNLSSEAQQSVHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVGR |
| Ga0316608_10442501 | 3300033420 | Microbial Mat | WQKASQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGLPLMKYL |
| Ga0316608_10742321 | 3300033420 | Microbial Mat | LGILARFQAFFYALSFSQSDGGTPSNPARVTQTFSPPLA |
| Ga0316608_10746243 | 3300033420 | Microbial Mat | LGILARFQAFFYALSFFQSDGVPPPAPARVTQTVRQIFGEIDL |
| Ga0316608_10966973 | 3300033420 | Microbial Mat | PTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLA |
| Ga0316611_10204071 | 3300033446 | Microbial Mat | PTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVGTPLAKLVKSKRD |
| Ga0316611_10623992 | 3300033446 | Microbial Mat | TLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVVPLL |
| Ga0316611_10631873 | 3300033446 | Microbial Mat | VHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQAVGHFLAE |
| Ga0316611_10673143 | 3300033446 | Microbial Mat | LGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLAQPK |
| Ga0316611_10853731 | 3300033446 | Microbial Mat | LGILARFQAFFYALSFSQSDGVPPPDPARVTQTVGQFLAKHH |
| Ga0316611_10865861 | 3300033446 | Microbial Mat | GILARFQAFFYASAFFQSDGVPPPAPARVTQTVSP |
| Ga0316611_11115542 | 3300033446 | Microbial Mat | VHPTLGILARFQAFFYASTFSQSDGVPPPTPARVTQTVRQIFGEIDL |
| Ga0316621_107757252 | 3300033488 | Soil | KTAQQSVHPTLGIRRHFQAVSYASAFFQSDGVPPPAPARVTPTVGRTNAFA |
| Ga0316621_113205681 | 3300033488 | Soil | AAQQSVHPTLVILARFQAFFYASAFSQADSVPPPAPAQVTQTVGQPPTQILN |
| Ga0316612_10918621 | 3300033494 | Microbial Mat | QSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGQLLAK |
| Ga0316610_10240561 | 3300033498 | Microbial Mat | LGILARFQAFFYALAFFQSDGVPPPAPARVTQTVRPPLAKLVFYNK |
| Ga0316610_10323571 | 3300033498 | Microbial Mat | VHPTLGILARFQAFFYASAFPQSDGVPPPDPARVTQTV |
| Ga0316610_10508431 | 3300033498 | Microbial Mat | LARFQAFFYALSFFQLDGVPPPAPARVTQTVRQIFGEIDL |
| Ga0316610_10749951 | 3300033498 | Microbial Mat | TLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVSP |
| Ga0316610_10752523 | 3300033498 | Microbial Mat | VHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLA |
| Ga0316610_11149061 | 3300033498 | Microbial Mat | LARFQAFFYALAFFQSDGVPPPDPARVTQTVSPPLAKGGIK |
| Ga0316616_1014716781 | 3300033521 | Soil | LGILARFQAFFYASAFFQSDGVPPPAPARVTQTVSRLSKIEMK |
| Ga0370502_0059669_282_449 | 3300034156 | Untreated Peat Soil | MQNAAQQSVHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGWLLAKLGK |
| Ga0370499_0120787_510_665 | 3300034194 | Untreated Peat Soil | MKEYAAQHSVHPTLGILARFQAFFYASAFFQFDGVPPPAPARVTQTVGQFM |
| ⦗Top⦘ |