


| Basic Information | |
|---|---|
| Family ID | F069724 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIP |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.24 % |
| % of genes near scaffold ends (potentially truncated) | 77.24 % |
| % of genes from short scaffolds (< 2000 bps) | 86.99 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.724 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.642 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.715 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 0.00% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00872 | Transposase_mut | 60.16 |
| PF13546 | DDE_5 | 1.63 |
| PF03972 | MmgE_PrpD | 0.81 |
| PF00239 | Resolvase | 0.81 |
| PF13565 | HTH_32 | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF05593 | RHS_repeat | 0.81 |
| PF00078 | RVT_1 | 0.81 |
| PF08281 | Sigma70_r4_2 | 0.81 |
| PF00216 | Bac_DNA_binding | 0.81 |
| PF09286 | Pro-kuma_activ | 0.81 |
| PF01841 | Transglut_core | 0.81 |
| PF16901 | DAO_C | 0.81 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 60.16 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.72 % |
| Unclassified | root | N/A | 42.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908028|beta3_all_NODE_52397_len_1486_cov_11_876851 | Not Available | 1536 | Open in IMG/M |
| 2124908035|B3_GZOS_CLC_ConsensusfromContig5949 | Not Available | 1618 | Open in IMG/M |
| 3300000317|WSSedL2TaDRAFT_1008771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300001593|JGI12635J15846_10683927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300001661|JGI12053J15887_10115472 | Not Available | 1440 | Open in IMG/M |
| 3300003351|JGI26346J50198_1017192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → alpha proteobacterium BAL199 | 703 | Open in IMG/M |
| 3300004080|Ga0062385_10045158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1869 | Open in IMG/M |
| 3300005559|Ga0066700_10771827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 650 | Open in IMG/M |
| 3300005566|Ga0066693_10258164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 691 | Open in IMG/M |
| 3300005569|Ga0066705_10026264 | All Organisms → cellular organisms → Bacteria | 3081 | Open in IMG/M |
| 3300006046|Ga0066652_100304986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1416 | Open in IMG/M |
| 3300007265|Ga0099794_10074385 | Not Available | 1668 | Open in IMG/M |
| 3300009089|Ga0099828_10236875 | Not Available | 1634 | Open in IMG/M |
| 3300009090|Ga0099827_11537610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 579 | Open in IMG/M |
| 3300009525|Ga0116220_10252482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 770 | Open in IMG/M |
| 3300009525|Ga0116220_10564802 | Not Available | 521 | Open in IMG/M |
| 3300009818|Ga0105072_1010595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 1622 | Open in IMG/M |
| 3300010045|Ga0126311_10115666 | Not Available | 1864 | Open in IMG/M |
| 3300010166|Ga0126306_10113644 | Not Available | 1973 | Open in IMG/M |
| 3300012096|Ga0137389_10077151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2594 | Open in IMG/M |
| 3300012285|Ga0137370_10107479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1577 | Open in IMG/M |
| 3300012357|Ga0137384_11384730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 551 | Open in IMG/M |
| 3300012362|Ga0137361_11507552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300012532|Ga0137373_10252357 | Not Available | 1424 | Open in IMG/M |
| 3300012925|Ga0137419_10999292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300014268|Ga0075309_1009923 | Not Available | 1934 | Open in IMG/M |
| 3300014495|Ga0182015_10046686 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300014495|Ga0182015_10962976 | Not Available | 531 | Open in IMG/M |
| 3300015068|Ga0167645_105537 | Not Available | 1446 | Open in IMG/M |
| 3300015241|Ga0137418_10086587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2834 | Open in IMG/M |
| 3300015241|Ga0137418_10597527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium australiense | 866 | Open in IMG/M |
| 3300018429|Ga0190272_12562676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 557 | Open in IMG/M |
| 3300018433|Ga0066667_10121823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1784 | Open in IMG/M |
| 3300019879|Ga0193723_1045948 | Not Available | 1289 | Open in IMG/M |
| 3300019886|Ga0193727_1183039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 537 | Open in IMG/M |
| 3300019887|Ga0193729_1066504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1431 | Open in IMG/M |
| 3300019999|Ga0193718_1040372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1025 | Open in IMG/M |
| 3300020083|Ga0194111_10511966 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300020150|Ga0187768_1020502 | Not Available | 1406 | Open in IMG/M |
| 3300020199|Ga0179592_10444661 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300020603|Ga0194126_10209478 | Not Available | 1386 | Open in IMG/M |
| 3300021073|Ga0210378_10062168 | Not Available | 1467 | Open in IMG/M |
| 3300021078|Ga0210381_10162306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300021081|Ga0210379_10067565 | Not Available | 1451 | Open in IMG/M |
| 3300021081|Ga0210379_10221627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 817 | Open in IMG/M |
| 3300021081|Ga0210379_10233821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300021344|Ga0193719_10076014 | Not Available | 1458 | Open in IMG/M |
| 3300023101|Ga0224557_1072503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1490 | Open in IMG/M |
| 3300025316|Ga0209697_10090768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2078 | Open in IMG/M |
| 3300025588|Ga0208586_1008491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2679 | Open in IMG/M |
| 3300025627|Ga0208220_1027561 | Not Available | 1780 | Open in IMG/M |
| 3300025664|Ga0208849_1040836 | Not Available | 1440 | Open in IMG/M |
| 3300026029|Ga0208002_1011478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 854 | Open in IMG/M |
| 3300026045|Ga0208535_1004299 | Not Available | 1455 | Open in IMG/M |
| 3300026046|Ga0208780_1018104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
| 3300026089|Ga0207648_10296775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1448 | Open in IMG/M |
| 3300026316|Ga0209155_1062383 | Not Available | 1425 | Open in IMG/M |
| 3300026318|Ga0209471_1108082 | Not Available | 1196 | Open in IMG/M |
| 3300026450|Ga0247847_1025613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300026843|Ga0208126_1000915 | Not Available | 1264 | Open in IMG/M |
| 3300026850|Ga0208892_1000764 | Not Available | 1503 | Open in IMG/M |
| 3300026891|Ga0208889_1009964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
| 3300026912|Ga0208520_1001630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300026995|Ga0208761_1001267 | Not Available | 1447 | Open in IMG/M |
| 3300027041|Ga0209876_1024669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300027523|Ga0208890_1030892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 807 | Open in IMG/M |
| 3300027561|Ga0209887_1022207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 1516 | Open in IMG/M |
| 3300027568|Ga0208042_1098475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 740 | Open in IMG/M |
| 3300027568|Ga0208042_1122705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300027616|Ga0209106_1115797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300027645|Ga0209117_1039332 | Not Available | 1443 | Open in IMG/M |
| 3300027655|Ga0209388_1078885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 948 | Open in IMG/M |
| 3300027696|Ga0208696_1070266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1193 | Open in IMG/M |
| 3300027701|Ga0209447_10213880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300027812|Ga0209656_10033253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3035 | Open in IMG/M |
| 3300027875|Ga0209283_10136991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1620 | Open in IMG/M |
| 3300027882|Ga0209590_10145768 | Not Available | 1464 | Open in IMG/M |
| 3300027898|Ga0209067_10192216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1095 | Open in IMG/M |
| 3300027957|Ga0209857_1014911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1537 | Open in IMG/M |
| 3300028069|Ga0255358_1010511 | Not Available | 1259 | Open in IMG/M |
| 3300028652|Ga0302166_10111847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| 3300028678|Ga0302165_10227884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
| 3300028796|Ga0307287_10052557 | Not Available | 1499 | Open in IMG/M |
| 3300028807|Ga0307305_10121317 | Not Available | 1208 | Open in IMG/M |
| 3300028814|Ga0307302_10078660 | Not Available | 1559 | Open in IMG/M |
| 3300028819|Ga0307296_10120471 | Not Available | 1410 | Open in IMG/M |
| 3300028867|Ga0302146_10124440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1049 | Open in IMG/M |
| 3300028884|Ga0307308_10090885 | Not Available | 1450 | Open in IMG/M |
| 3300029442|Ga0239579_1008675 | Not Available | 2183 | Open in IMG/M |
| 3300030014|Ga0302175_10078147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 738 | Open in IMG/M |
| 3300030399|Ga0311353_10451311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1148 | Open in IMG/M |
| 3300030706|Ga0310039_10404005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 503 | Open in IMG/M |
| 3300031114|Ga0308187_10244141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
| 3300031198|Ga0307500_10019059 | Not Available | 1463 | Open in IMG/M |
| 3300031456|Ga0307513_10713242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 709 | Open in IMG/M |
| 3300031524|Ga0302320_11409141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 693 | Open in IMG/M |
| 3300031595|Ga0265313_10248385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 726 | Open in IMG/M |
| 3300031740|Ga0307468_100298028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1168 | Open in IMG/M |
| 3300031740|Ga0307468_101094543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 709 | Open in IMG/M |
| 3300031753|Ga0307477_10171063 | Not Available | 1514 | Open in IMG/M |
| 3300031754|Ga0307475_10238779 | Not Available | 1455 | Open in IMG/M |
| 3300031823|Ga0307478_11624562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300031965|Ga0326597_10422234 | Not Available | 1475 | Open in IMG/M |
| 3300032061|Ga0315540_10085056 | Not Available | 1467 | Open in IMG/M |
| 3300032160|Ga0311301_10456878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1920 | Open in IMG/M |
| 3300032174|Ga0307470_11404392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
| 3300032174|Ga0307470_11883187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
| 3300032177|Ga0315276_10367039 | Not Available | 1538 | Open in IMG/M |
| 3300032177|Ga0315276_12559773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 510 | Open in IMG/M |
| 3300032401|Ga0315275_10451259 | Not Available | 1441 | Open in IMG/M |
| 3300032401|Ga0315275_11483538 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300033158|Ga0335077_11913277 | Not Available | 554 | Open in IMG/M |
| 3300033407|Ga0214472_10167949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2140 | Open in IMG/M |
| 3300033407|Ga0214472_10330089 | Not Available | 1445 | Open in IMG/M |
| 3300033813|Ga0364928_0015171 | Not Available | 1488 | Open in IMG/M |
| 3300034071|Ga0335028_0238072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1108 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.20% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.06% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.25% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.25% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.25% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.44% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.63% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.81% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.81% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 3300000317 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L2 Tule | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026450 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25 | Environmental | Open in IMG/M |
| 3300026843 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA (SPAdes) | Environmental | Open in IMG/M |
| 3300026850 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC (SPAdes) | Environmental | Open in IMG/M |
| 3300026891 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB (SPAdes) | Environmental | Open in IMG/M |
| 3300026912 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| beta3_all_00866560 | 2124908028 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPRIGQRPF |
| B3_GZOS_CLC_02297100 | 2124908035 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSSYFNIGRDIPRIGQRPF |
| WSSedL2TaDRAFT_10087711 | 3300000317 | Wetland | MALLSFRGIDTPSLQAQGEQRLPPIFNIQRDIPRA |
| JGI12635J15846_106839272 | 3300001593 | Forest Soil | MLDVFMALLSFRGIDTPSLPAQGEQRRSAYFNIGRD |
| JGI12053J15887_101154723 | 3300001661 | Forest Soil | MVDVFMALLSSRGFDTPSLSAQGEQRRSTYFNIGRDIPQND |
| JGI26346J50198_10171922 | 3300003351 | Bog Forest Soil | MALLSLRGFDTPSLPAQGGQRLLSYFNINRDIPLQTHDAHA |
| Ga0062385_100451583 | 3300004080 | Bog Forest Soil | MALLSLRGFDTPSLPAQGGQRLLSYFNINRDIPACTAKSDLR* |
| Ga0066700_107718271 | 3300005559 | Soil | VLNLFMALLSFRGFDTPSLQAQGEQRRSSFFNIGRDIP |
| Ga0066693_102581641 | 3300005566 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIDRDI |
| Ga0066705_100262644 | 3300005569 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIP* |
| Ga0066652_1003049862 | 3300006046 | Soil | AVVIMVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIP* |
| Ga0099794_100743851 | 3300007265 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDIS |
| Ga0099828_102368751 | 3300009089 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISSET* |
| Ga0099827_115376101 | 3300009090 | Vadose Zone Soil | ILFMALLSFRGIITPSLPAQGEQRRPSFFNIGRDIP* |
| Ga0116220_102524822 | 3300009525 | Peatlands Soil | MALLSFRGISTPSLPAQGEQRRFSFFNIRRDIPMSFQYGERA* |
| Ga0116220_105648021 | 3300009525 | Peatlands Soil | SFRGISTPSLPAQGEQRRFSYFNIQRDIPVQLPWHI* |
| Ga0105072_10105952 | 3300009818 | Groundwater Sand | MALLLLRGFSTPSLLAQGEQRLPSYFNIDRDIPHESIG* |
| Ga0126311_101156663 | 3300010045 | Serpentine Soil | MALLAPRGFSTPSLPAQGGQRRLLFLNIDRDIAGFPPDPPL* |
| Ga0126306_101136443 | 3300010166 | Serpentine Soil | MALLSFRGIDTPSLPAQGEQRRPIYFNIDRDISGDF |
| Ga0137389_100771512 | 3300012096 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISSLPTASR* |
| Ga0137370_101074791 | 3300012285 | Vadose Zone Soil | MALLSSRGISTPSLQAQGEQRRFSYFNNHRDIAGSI |
| Ga0137384_113847302 | 3300012357 | Vadose Zone Soil | MVDVFMVLLSFCGFDTPSLPAQGGQRLPSYFNIDRDIPE |
| Ga0137361_115075522 | 3300012362 | Vadose Zone Soil | MALVIMLDVFMALLSFRGISTPSLPAQGEQRRLSDFNIDRDNPDERCGRLL* |
| Ga0137373_102523571 | 3300012532 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISC* |
| Ga0137359_102364054 | 3300012923 | Vadose Zone Soil | LNLFMALLSFRGISTPSLPAQGEQRRSFYFNIRRDILFSIP* |
| Ga0137419_109992921 | 3300012925 | Vadose Zone Soil | MVDVFMALLSFCGFDTPSLPAQGEQRRSTYFNIGRDIPLGNAAA* |
| Ga0075309_10099231 | 3300014268 | Natural And Restored Wetlands | MLDLFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDNSLPLR* |
| Ga0182015_100466861 | 3300014495 | Palsa | IFMALLSSRGIITPSLTAQGEQRRSFFFNIPRDIPPTGARAI* |
| Ga0182015_109629761 | 3300014495 | Palsa | LLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPIVQ* |
| Ga0167645_1055371 | 3300015068 | Glacier Forefield Soil | MVDVFMALLSFRGFDTPSLSAQGEQRRFTYFNIGRDIPMSL |
| Ga0137418_100865876 | 3300015241 | Vadose Zone Soil | HALPTGALGIALVIMVDVFMALLSFRGFDTPSLSAQGEQRRFTYFNIGRDIP* |
| Ga0137418_105975271 | 3300015241 | Vadose Zone Soil | MALLSFRGFDTPSLSAQGEQRRSSYFNIRRDIPRR |
| Ga0187767_102722852 | 3300017999 | Tropical Peatland | MALLSSRGISTPSLQAQGKQRRSSYFNNDWDIAKMK |
| Ga0190272_125626762 | 3300018429 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPSAGLESL |
| Ga0066667_101218232 | 3300018433 | Grasslands Soil | GIALIIMVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIP |
| Ga0193715_10179591 | 3300019878 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIDRDIPESDYRLLMGSGM |
| Ga0193723_10459481 | 3300019879 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPGC |
| Ga0193727_11830391 | 3300019886 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDI |
| Ga0193729_10665041 | 3300019887 | Soil | MALLSFRGISTPSLLAQGEQRRSSFFNIPRDIPLATP |
| Ga0193718_10403722 | 3300019999 | Soil | MVDVFMALLSFRGFDTPSLSAQGEQRRFTYFNIGRDIP |
| Ga0194111_105119662 | 3300020083 | Freshwater Lake | FMSLLSFRGISTPSLQAQGEQRRSSYFNIGRDIASRALISG |
| Ga0187768_10203811 | 3300020150 | Tropical Peatland | MALLSSRGISTPSLQAQGEQRRSSYFNNDRDIATLNVLLSF |
| Ga0187768_10205022 | 3300020150 | Tropical Peatland | MALLSFVESSTPSLQAQGEQRRSFFFNIPRDNSQAD |
| Ga0179592_104446612 | 3300020199 | Vadose Zone Soil | AVAVVILVFMALLSFRGISTPSLSAQGEQRRPSFFNIRRDIP |
| Ga0194126_102094781 | 3300020603 | Freshwater Lake | MALLSFRGFNTPSLPAQGEQRRSSYFNIDRDIPSR |
| Ga0210378_100621682 | 3300021073 | Groundwater Sediment | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPVTVLARRI |
| Ga0210381_101623062 | 3300021078 | Groundwater Sediment | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPPNMN |
| Ga0210379_100675651 | 3300021081 | Groundwater Sediment | MALLSFRGISTPSLPAQGEQRRSFYFNIRRDIPKRAG |
| Ga0210379_102216271 | 3300021081 | Groundwater Sediment | MVDVFMALLSFRGFDTPSLQAQGEQRRSTYFNIGRDIPSLDPGS |
| Ga0210379_102338212 | 3300021081 | Groundwater Sediment | LVIMVDVFMALLSFRGFDTPSLQAQGEQRRSTYFNIGRDIPHGPR |
| Ga0193719_100760141 | 3300021344 | Soil | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPCFGGSNL |
| Ga0224557_10725031 | 3300023101 | Soil | MALLSFRGISTPSLQAQGEQRRSSYFNNDRDIASMRSPR |
| Ga0209697_100907681 | 3300025316 | Freshwater Lake Hypolimnion | MALLSFRGFDTPSLQAQGEQRLLYNFNIDRDISYGPRVAPYWQRG |
| Ga0208586_10084913 | 3300025588 | Arctic Peat Soil | MVDVFMALLSFRGISTPSLSAQGEQRRSTYFNIGREYVMQS |
| Ga0208220_10275613 | 3300025627 | Arctic Peat Soil | MVDVFMALLSFRGISTPSLSAQGEQRRSTYFNIGRDIPI |
| Ga0208849_10408362 | 3300025664 | Arctic Peat Soil | MVDVFMALLSFRGISTPSLSAQGEQRRSTYFNIGRDIPR |
| Ga0208002_10114781 | 3300026029 | Natural And Restored Wetlands | MLDLFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDNS |
| Ga0208535_10042991 | 3300026045 | Natural And Restored Wetlands | MLDLFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDNSQPRP |
| Ga0208780_10181041 | 3300026046 | Natural And Restored Wetlands | MLDLFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDNSN |
| Ga0207648_102967751 | 3300026089 | Miscanthus Rhizosphere | MVDVFMALLSFRGISTPSLPAQGEQRRSSYFNIPRGNSALCYHQDIQVTV |
| Ga0209155_10623833 | 3300026316 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIDRDIPFS |
| Ga0209471_11080822 | 3300026318 | Soil | MVGVFMALLSFRGFDTPSLPAQGEQRRSTYFNIDRDIPRAEMA |
| Ga0247847_10256132 | 3300026450 | Soil | MALLSSRGISTPSLPAQGEQRRSSIFNIPRDILEAISS |
| Ga0208126_10009152 | 3300026843 | Soil | MALLLLRGFSTPSLLAQGEQRLPSFFNIRRDIPLMIFPD |
| Ga0208892_10007642 | 3300026850 | Soil | MALLLLRGFSTPSLLAQGEQRLPSYFNIRRDIPYCA |
| Ga0208889_10099642 | 3300026891 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIP |
| Ga0208520_10016301 | 3300026912 | Soil | MALLSFRGFGTPSLPAQGEQRRSTYFNIGRDIPRP |
| Ga0208761_10012671 | 3300026995 | Soil | MALLLLRGFSTPSLLAQGEQRLPSFFNIRRDIPACG |
| Ga0209876_10246692 | 3300027041 | Groundwater Sand | MALLLLRGFSTPSLLAQGEQRLPSYFNIDRDIPMIWHSS |
| Ga0209524_10091121 | 3300027521 | Forest Soil | MALLSSRGISTPSLQAQGEQRRSSYFNNHQDIADF |
| Ga0208890_10308922 | 3300027523 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPS |
| Ga0209887_10222073 | 3300027561 | Groundwater Sand | MALLLLRGFSTPSLLAQGEQRLPSYFNIDRDIPARK |
| Ga0208042_10984752 | 3300027568 | Peatlands Soil | MALLSFRGISTPSLPAQGEQRRFSFFNIRRDIPMSFQYGERA |
| Ga0208042_11227051 | 3300027568 | Peatlands Soil | MALLSFRGISTPSLPAQGEQRRFSYFNIQRDIPVQLPWHI |
| Ga0209106_11157971 | 3300027616 | Forest Soil | MALLSFVGISTPSLPAQGEQRRSSIFNIPRDIPIDR |
| Ga0209117_10393321 | 3300027645 | Forest Soil | MLDVFMALLSFRGIDTPSLPAQGEQRRSAYFNIGR |
| Ga0209388_10788851 | 3300027655 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISNAGR |
| Ga0208565_10597642 | 3300027662 | Peatlands Soil | MALLSSRGISTPSLQAQGEQRRSSYFNIHRDIALASAISFD |
| Ga0208696_10702661 | 3300027696 | Peatlands Soil | MALLSSRGISTPSLQAQGEQRRSSYFNIHRDIASRSD |
| Ga0209447_102138802 | 3300027701 | Bog Forest Soil | MALLSLRGFDTPSLPAQGGQRLLSYFNINRDIPLGFLKRLC |
| Ga0209328_100290944 | 3300027727 | Forest Soil | MALLSSRGISTPSLQAQGKQRRSSYFNNDRDIAGVDRRDRH |
| Ga0209656_100332534 | 3300027812 | Bog Forest Soil | MALLSFRGFDTPSLPAQGEQRRFSFFNIRRDIGYTGSRTA |
| Ga0209283_101369911 | 3300027875 | Vadose Zone Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISDESPR |
| Ga0209590_101457681 | 3300027882 | Vadose Zone Soil | MVDLFMALLSFRGFDTPSLPAQGEQRRSFYFNIDRDISPLP |
| Ga0209067_101922161 | 3300027898 | Watersheds | MALLSSRGISTPSLQAQGEQRRSSYFNNDRDIAPKGFN |
| Ga0209857_10149112 | 3300027957 | Groundwater Sand | MALLLLRGFSTPSLLAQGEQRLPSYFNIDRDIPDL |
| Ga0255358_10105111 | 3300028069 | Soil | MALLSSRGISTPSLPAQGEQRRSSIFNIPRDILIEAIA |
| Ga0302166_101118472 | 3300028652 | Fen | MALLSFRGFDTPSLSAQGEQRRSTYFNIGRDIPAAIA |
| Ga0302165_102278841 | 3300028678 | Fen | MALLSFRGFDTPSLSAQGEQRRSTYFNIGRDIPGAGWAIAT |
| Ga0307287_100525571 | 3300028796 | Soil | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPNIHST |
| Ga0307305_101213171 | 3300028807 | Soil | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPNDQSRI |
| Ga0307302_100786602 | 3300028814 | Soil | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPKL |
| Ga0307296_101204712 | 3300028819 | Soil | MALLSLRGFDTPSLTAQGGQRLPFYFNIDRDIPCND |
| Ga0302146_101244401 | 3300028867 | Bog | MALLSSRGISTPSLPAQGEQRRSSIFNIPRDIPRQWIKNG |
| Ga0307308_100908851 | 3300028884 | Soil | MVDVFMALLSFRGFDTPSPPAQGEQRRSTYFNIGRDIPGKHHG |
| Ga0239579_10086751 | 3300029442 | Freshwater Lake | MALLSFHGFDTQSLQAQGQQRLPHIFNIQRDIPANDSAVCC |
| Ga0302175_100781471 | 3300030014 | Fen | MALLSFRGFDTPSLSAQGEQRRSTYFNIGRDIPTQCL |
| Ga0311353_104513111 | 3300030399 | Palsa | MALLSFVGISTPSLKAQGEQRRSFLFNIPRDIPPLLIDRELVAA |
| Ga0310039_104040052 | 3300030706 | Peatlands Soil | MALLSFRGISTPSLQAQGEQRCSSYFNNDRDIAHI |
| Ga0308187_102441411 | 3300031114 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIDRDIPSLGA |
| Ga0307500_100190592 | 3300031198 | Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPQ |
| Ga0307513_107132421 | 3300031456 | Ectomycorrhiza | MVDVFMALLSSRGFDTPSLSAQGEQRRSTYFNNGRD |
| Ga0302320_114091412 | 3300031524 | Bog | MALLSSRGISTPSLPAQGEQRRSSIFNIPRDIPELIAGFHILSN |
| Ga0265313_102483852 | 3300031595 | Rhizosphere | VIGLFMALLSFRGISTPSLPAQGEQRRFSFFNIHRDIPVIKL |
| Ga0307468_1002980282 | 3300031740 | Hardwood Forest Soil | MVDVFMALLSFCGFDTPSLPAQGEQRRSTYFNIARDIP |
| Ga0307468_1010945432 | 3300031740 | Hardwood Forest Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPH |
| Ga0307477_101710631 | 3300031753 | Hardwood Forest Soil | MALLSFVESSTPSLQAQGEQRRSFFFNIPRDNSHS |
| Ga0307475_102387791 | 3300031754 | Hardwood Forest Soil | MVDVFMALLSFRGISTPSLPAQGEQRRSSLFNIGRDIPPK |
| Ga0307478_116245621 | 3300031823 | Hardwood Forest Soil | MALLSFVESSTPSLQAQGEQRRSFFFNIPRDNSRA |
| Ga0326597_104222341 | 3300031965 | Soil | MALLSFVGFDTPSLPAQGEQRLPHIFNIGRDIPVHNVQKTLSFAA |
| Ga0315540_100850561 | 3300032061 | Salt Marsh Sediment | MALLSFVGFDTPSLPAQGEQRLPHIFNINRDIPRGTI |
| Ga0311301_104568781 | 3300032160 | Peatlands Soil | MALLSFRGISTPSLPAQGEQRRFSYFNIQRDIPGYGLGKDS |
| Ga0307470_114043922 | 3300032174 | Hardwood Forest Soil | MVDVFMALLSFRGFDTPSLPAQGEQRRSTYFNIGRDIPRWTYERG |
| Ga0307470_118831871 | 3300032174 | Hardwood Forest Soil | MVDVFMALLSFCGFDTPSLPAQGEQRRSTYFNIAWDIPSAS |
| Ga0315276_103670392 | 3300032177 | Sediment | MALLSFRGFDTPSLPAQGEQRRSSYFNINRDITRNW |
| Ga0315276_125597731 | 3300032177 | Sediment | AAIVIDFFMALLSFRGFDTPSLPAQGEQRRSSYFNINRDITPWISSL |
| Ga0315275_104512591 | 3300032401 | Sediment | MALLSFRGFDTPSLPAQGEQRRSSYFNINRDITTVE |
| Ga0315275_114835381 | 3300032401 | Sediment | NAAAIVIDFFMALLSFRGFDTPSLPAQGEQRRSSYFNINRDIPHP |
| Ga0335077_119132772 | 3300033158 | Soil | RLFMALLSFVESSTPSLQAQGEQRRSFFFNIPRDIS |
| Ga0214472_101679491 | 3300033407 | Soil | VDFFMALLSFIGFDTPSLPAQGEQRLPHIFNIGRDIPSLDK |
| Ga0214472_103300892 | 3300033407 | Soil | MALLSFRGFDTPSLPAQGEQRRSSYFNIDRDIPRRNVWT |
| Ga0364928_0015171_1349_1468 | 3300033813 | Sediment | MALLLLRGFSTPSLLAQGEQRLPSYFNIRRDIPALNAEG |
| Ga0335028_0238072_995_1108 | 3300034071 | Freshwater | FMALLASRGFDTPSLAAQGRQRRSRFLNIGRDIPELR |
| ⦗Top⦘ |