


| Basic Information | |
|---|---|
| Family ID | F065812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KLLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 45.60 % |
| % of genes near scaffold ends (potentially truncated) | 54.33 % |
| % of genes from short scaffolds (< 2000 bps) | 96.06 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (66.142 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter (12.598 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.898 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (29.921 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF11751 | PorP_SprF | 0.79 |
| PF00614 | PLDc | 0.79 |
| PF14492 | EFG_III | 0.79 |
| PF07991 | IlvN | 0.79 |
| PF13585 | CHU_C | 0.79 |
| PF00005 | ABC_tran | 0.79 |
| PF00124 | Photo_RC | 0.79 |
| PF13668 | Ferritin_2 | 0.79 |
| PF00313 | CSD | 0.79 |
| PF02788 | RuBisCO_large_N | 0.79 |
| PF13428 | TPR_14 | 0.79 |
| PF01757 | Acyl_transf_3 | 0.79 |
| PF13229 | Beta_helix | 0.79 |
| PF06398 | Pex24p | 0.79 |
| PF01386 | Ribosomal_L25p | 0.79 |
| PF02972 | Phycoerythr_ab | 0.79 |
| PF02676 | TYW3 | 0.79 |
| PF03466 | LysR_substrate | 0.79 |
| PF02482 | Ribosomal_S30AE | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.57 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.79 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 0.79 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1590 | tRNA(Phe) wybutosine-synthesizing methylase Tyw3 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.74 % |
| Unclassified | root | N/A | 21.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000305|bgg_mtDRAFT_1003811 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 676 | Open in IMG/M |
| 3300004595|Ga0008278_1094678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas vasicola | 794 | Open in IMG/M |
| 3300004767|Ga0007750_1046405 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1142 | Open in IMG/M |
| 3300004769|Ga0007748_10130510 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7781 | Open in IMG/M |
| 3300004769|Ga0007748_10160304 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300004769|Ga0007748_10178935 | All Organisms → cellular organisms → Eukaryota | 594 | Open in IMG/M |
| 3300004769|Ga0007748_10181511 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300004769|Ga0007748_10190409 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 981 | Open in IMG/M |
| 3300004788|Ga0007742_10046144 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300004789|Ga0007752_10189897 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004794|Ga0007751_10086578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas vasicola | 1250 | Open in IMG/M |
| 3300005421|Ga0068882_1152600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005644|Ga0075036_1141779 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006378|Ga0075498_1113623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 507 | Open in IMG/M |
| 3300006390|Ga0075509_1025128 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 718 | Open in IMG/M |
| 3300006404|Ga0075515_10095954 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 936 | Open in IMG/M |
| 3300006644|Ga0099767_1022642 | Not Available | 660 | Open in IMG/M |
| 3300006680|Ga0031699_101751 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 604 | Open in IMG/M |
| 3300006688|Ga0031687_1115543 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 646 | Open in IMG/M |
| 3300006699|Ga0031696_1007494 | All Organisms → cellular organisms → Eukaryota | 598 | Open in IMG/M |
| 3300006699|Ga0031696_1210363 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 604 | Open in IMG/M |
| 3300006718|Ga0005504_1295101 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 630 | Open in IMG/M |
| 3300007159|Ga0075020_116725 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 620 | Open in IMG/M |
| 3300007159|Ga0075020_117072 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 622 | Open in IMG/M |
| 3300007225|Ga0099776_1086572 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 589 | Open in IMG/M |
| 3300007228|Ga0075175_1028228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Volvocaceae → Volvox → Volvox carteri | 562 | Open in IMG/M |
| 3300007342|Ga0079227_1362853 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 602 | Open in IMG/M |
| 3300007526|Ga0075022_1002605 | All Organisms → cellular organisms → Eukaryota | 564 | Open in IMG/M |
| 3300007599|Ga0102780_1207748 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 533 | Open in IMG/M |
| 3300008760|Ga0103911_100002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 2127 | Open in IMG/M |
| 3300008779|Ga0103594_10267 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 580 | Open in IMG/M |
| 3300008781|Ga0103596_10569 | Not Available | 580 | Open in IMG/M |
| 3300008917|Ga0103482_1004487 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300008920|Ga0103485_102564 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 616 | Open in IMG/M |
| 3300008937|Ga0103740_1011386 | All Organisms → cellular organisms → Eukaryota | 954 | Open in IMG/M |
| 3300009225|Ga0103851_1082305 | Not Available | 571 | Open in IMG/M |
| 3300009580|Ga0115596_1014491 | Not Available | 807 | Open in IMG/M |
| 3300009679|Ga0115105_11006979 | Not Available | 644 | Open in IMG/M |
| 3300009757|Ga0123367_1068462 | Not Available | 637 | Open in IMG/M |
| 3300010100|Ga0127440_1066292 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 590 | Open in IMG/M |
| 3300010120|Ga0127451_1113932 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 528 | Open in IMG/M |
| 3300010867|Ga0126347_1480866 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 572 | Open in IMG/M |
| 3300011120|Ga0150983_11098158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300011329|Ga0138367_1011225 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 641 | Open in IMG/M |
| 3300012224|Ga0134028_1006099 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 651 | Open in IMG/M |
| 3300012373|Ga0134042_1175430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha3_Bin4 | 838 | Open in IMG/M |
| 3300012389|Ga0134040_1025248 | All Organisms → cellular organisms → Eukaryota | 587 | Open in IMG/M |
| 3300012705|Ga0157555_1128000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-6 | 1487 | Open in IMG/M |
| 3300012714|Ga0157601_1155737 | All Organisms → cellular organisms → Eukaryota | 1009 | Open in IMG/M |
| 3300012719|Ga0157600_1047412 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 902 | Open in IMG/M |
| 3300012734|Ga0157615_1130198 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1492 | Open in IMG/M |
| 3300012784|Ga0157523_130518 | All Organisms → cellular organisms → Eukaryota | 598 | Open in IMG/M |
| 3300012970|Ga0129338_1134794 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 600 | Open in IMG/M |
| 3300013051|Ga0164274_117930 | All Organisms → cellular organisms → Eukaryota | 842 | Open in IMG/M |
| 3300013054|Ga0164284_104814 | Not Available | 507 | Open in IMG/M |
| 3300013054|Ga0164284_106357 | All Organisms → cellular organisms → Eukaryota | 648 | Open in IMG/M |
| 3300013295|Ga0170791_10013789 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 623 | Open in IMG/M |
| 3300016726|Ga0182045_1007827 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 567 | Open in IMG/M |
| 3300019167|Ga0184571_112675 | Not Available | 751 | Open in IMG/M |
| 3300019200|Ga0180036_1004465 | Not Available | 634 | Open in IMG/M |
| 3300019221|Ga0179941_1034391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 910 | Open in IMG/M |
| 3300019258|Ga0181504_1423505 | All Organisms → cellular organisms → Eukaryota | 719 | Open in IMG/M |
| 3300021282|Ga0210303_1093419 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales | 880 | Open in IMG/M |
| 3300021284|Ga0210299_164199 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Volvocaceae → Volvox → Volvox carteri → Volvox carteri f. nagariensis | 504 | Open in IMG/M |
| 3300021291|Ga0206694_1018463 | Not Available | 595 | Open in IMG/M |
| 3300021312|Ga0210306_1214252 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 621 | Open in IMG/M |
| 3300021333|Ga0210324_1070169 | All Organisms → cellular organisms → Eukaryota | 831 | Open in IMG/M |
| 3300021336|Ga0210307_1159160 | All Organisms → cellular organisms → Eukaryota | 1861 | Open in IMG/M |
| 3300021345|Ga0206688_10224325 | All Organisms → cellular organisms → Eukaryota | 826 | Open in IMG/M |
| 3300021845|Ga0210297_1096421 | Not Available | 565 | Open in IMG/M |
| 3300021847|Ga0210305_1116054 | Not Available | 573 | Open in IMG/M |
| 3300021909|Ga0213846_1011462 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 590 | Open in IMG/M |
| 3300021929|Ga0213845_1198601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 557 | Open in IMG/M |
| 3300022369|Ga0210310_1011095 | Not Available | 881 | Open in IMG/M |
| 3300022501|Ga0242645_1009510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 753 | Open in IMG/M |
| 3300022502|Ga0242646_1003427 | Not Available | 1085 | Open in IMG/M |
| 3300022505|Ga0242647_1022680 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 639 | Open in IMG/M |
| 3300022505|Ga0242647_1030382 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 580 | Open in IMG/M |
| 3300022507|Ga0222729_1063927 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 532 | Open in IMG/M |
| 3300022508|Ga0222728_1008122 | Not Available | 1307 | Open in IMG/M |
| 3300022718|Ga0242675_1071546 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 621 | Open in IMG/M |
| 3300023697|Ga0228706_1022153 | All Organisms → cellular organisms → Eukaryota | 777 | Open in IMG/M |
| 3300023697|Ga0228706_1030368 | Not Available | 669 | Open in IMG/M |
| 3300023703|Ga0228708_1038514 | All Organisms → cellular organisms → Eukaryota | 714 | Open in IMG/M |
| 3300023708|Ga0228709_1036420 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Saprolegniales → Saprolegniaceae | 1024 | Open in IMG/M |
| 3300023708|Ga0228709_1100164 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 587 | Open in IMG/M |
| 3300024859|Ga0255278_1057889 | Not Available | 764 | Open in IMG/M |
| 3300024864|Ga0255271_1087150 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 683 | Open in IMG/M |
| 3300026405|Ga0256296_1016955 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 859 | Open in IMG/M |
| 3300026421|Ga0247569_1003646 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum | 2268 | Open in IMG/M |
| 3300026461|Ga0247600_1026150 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1110 | Open in IMG/M |
| 3300026462|Ga0247568_1093574 | Not Available | 589 | Open in IMG/M |
| 3300028621|Ga0257142_1052733 | All Organisms → cellular organisms → Eukaryota | 731 | Open in IMG/M |
| 3300030548|Ga0210252_10064686 | Not Available | 652 | Open in IMG/M |
| 3300030722|Ga0308137_1065649 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 645 | Open in IMG/M |
| 3300030769|Ga0315894_103942 | All Organisms → cellular organisms → Eukaryota | 998 | Open in IMG/M |
| 3300030785|Ga0102757_10067072 | All Organisms → cellular organisms → Eukaryota | 897 | Open in IMG/M |
| 3300030792|Ga0265790_119067 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300030816|Ga0265729_101569 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 733 | Open in IMG/M |
| 3300030820|Ga0315872_110204 | Not Available | 811 | Open in IMG/M |
| 3300030822|Ga0315851_118196 | Not Available | 511 | Open in IMG/M |
| 3300030823|Ga0315870_105419 | All Organisms → cellular organisms → Eukaryota | 811 | Open in IMG/M |
| 3300030890|Ga0315875_113836 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Phaeosphaeriaceae → Parastagonospora → Parastagonospora nodorum → Parastagonospora nodorum SN15 | 818 | Open in IMG/M |
| 3300030896|Ga0315859_112321 | All Organisms → cellular organisms → Eukaryota | 632 | Open in IMG/M |
| 3300030927|Ga0315873_113030 | Not Available | 643 | Open in IMG/M |
| 3300031005|Ga0073974_1002322 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 540 | Open in IMG/M |
| 3300031006|Ga0073973_1728723 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 629 | Open in IMG/M |
| 3300031026|Ga0315862_106636 | All Organisms → cellular organisms → Eukaryota | 746 | Open in IMG/M |
| 3300031061|Ga0315844_116379 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 525 | Open in IMG/M |
| 3300031069|Ga0315846_101638 | All Organisms → cellular organisms → Eukaryota | 1270 | Open in IMG/M |
| 3300031079|Ga0315843_114667 | Not Available | 576 | Open in IMG/M |
| 3300031101|Ga0315841_106813 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1003 | Open in IMG/M |
| 3300031130|Ga0315814_115522 | All Organisms → cellular organisms → Eukaryota | 610 | Open in IMG/M |
| 3300031426|Ga0315835_109605 | Not Available | 843 | Open in IMG/M |
| 3300031428|Ga0315832_107475 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae | 1119 | Open in IMG/M |
| 3300031955|Ga0316035_111507 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 670 | Open in IMG/M |
| 3300032514|Ga0214502_1051310 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1496 | Open in IMG/M |
| 3300032515|Ga0348332_13625992 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii | 785 | Open in IMG/M |
| 3300032593|Ga0321338_1090079 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Pyrenophora → Pyrenophora teres → Pyrenophora teres f. teres → Pyrenophora teres f. teres 0-1 | 1066 | Open in IMG/M |
| 3300032593|Ga0321338_1207383 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 704 | Open in IMG/M |
| 3300032711|Ga0314681_10572283 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 631 | Open in IMG/M |
| 3300033523|Ga0314768_1103457 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | 991 | Open in IMG/M |
| 3300033530|Ga0314760_1135323 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 604 | Open in IMG/M |
| 3300033532|Ga0314767_1158384 | Not Available | 568 | Open in IMG/M |
| 3300034678|Ga0314803_030915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 850 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 12.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.66% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.09% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 4.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.15% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 3.94% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.57% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.57% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.57% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 1.57% |
| Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 1.57% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.79% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.79% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.79% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.79% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.79% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300004595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006644 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A2_L (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006680 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2966 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006688 | Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1089 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006699 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2156 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006718 | Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007159 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007225 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_B4L_H (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007228 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007342 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007526 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007599 | Marine microbial communities from the Southern Atlantic ocean - KN S15 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008760 | Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3002 | Environmental | Open in IMG/M |
| 3300008779 | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 30m_>1.6micron | Environmental | Open in IMG/M |
| 3300008781 | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron | Environmental | Open in IMG/M |
| 3300008917 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KB1 | Environmental | Open in IMG/M |
| 3300008920 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA2 | Environmental | Open in IMG/M |
| 3300008937 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3C | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011329 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 250_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012784 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES001 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013051 | Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 3rd pass 30_C BE-Lig BY (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013054 | Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 5th pass 30_C BE-Lig BY (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019167 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019221 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021284 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021845 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021847 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022369 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023697 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023703 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026405 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026461 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028621 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030722 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030769 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030792 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030820 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030822 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T21 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030823 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T27 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030890 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030896 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030927 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031005 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031006 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031026 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031061 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031069 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031079 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031101 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031130 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031426 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031428 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T15 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031955 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032711 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| bgg_mtDRAFT_10038112 | 3300000305 | Host-Associated | MGDKLLLKLNIYGKPIANKYCEGKMKRTLKRGLKDLKSLKRKR* |
| Ga0008278_10946781 | 3300004595 | Marine | KLLLRLNICGKPIANKYCEGKMKSTLERESKDLKPLRRKRWR* |
| Ga0007750_10464053 | 3300004767 | Freshwater Lake | LLLRLNICRKPIANKYCEGKMKSALERGSKDLKPLRRKR* |
| Ga0007748_101305101 | 3300004769 | Freshwater Lake | VGDRLLLRLNICRKPIANKYCEGKMKSALERGSKDLKPLRSIK* |
| Ga0007748_101603042 | 3300004769 | Freshwater Lake | KLLLRLNICGKPIANKYCEGKMKSTLERESKDLKPLRRKRPERSTQGRK* |
| Ga0007748_101789352 | 3300004769 | Freshwater Lake | KLLLRLNICGKPIANKYCEGKMKSTLERESKDLKPLRRKRN* |
| Ga0007748_101815111 | 3300004769 | Freshwater Lake | LLLRLNIYGKPIANKYCEGKMKRTLKRGSKDLKSLRRKR* |
| Ga0007748_101904092 | 3300004769 | Freshwater Lake | GDKLLLKLNIYGKPIANKYCEGKMKRTLKRGLKDLKSLKRRAASGARLRPDDYT* |
| Ga0007742_100461442 | 3300004788 | Freshwater Lake | VGDRLLLRLNICRKPIANKYCEGKMKSALERGSKDLKPLRITTVI* |
| Ga0007752_101898972 | 3300004789 | Freshwater Lake | LLLRLNIYGKPIANKYCEGKMKRTLKRESKDLKSLRRKE* |
| Ga0007751_100865782 | 3300004794 | Freshwater Lake | LLLKLNNYEKPIANKYYEGKMKRTLKRGLKDLKSDKDTR* |
| Ga0007763_101008022 | 3300004796 | Freshwater Lake | MILPKLNIDGRPIVDKYCEGKMKRTLKREGKDLKSLRRN* |
| Ga0068882_11526001 | 3300005421 | Freshwater Lake | GKLLLRLNIYRKPIAYKYCEGKMKRTLKRGLKDLKSLKRKR* |
| Ga0075036_11417792 | 3300005644 | Permafrost Soil | DKLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKR* |
| Ga0075498_11136232 | 3300006378 | Aqueous | MGDKLLLKLNIYVKPIAYKYFEGKMKRTLKRGLKDLKALRRKR* |
| Ga0075509_10251281 | 3300006390 | Aqueous | LNIYGKPIANKYCEGKMKSTLERESKDLKPLRRKR* |
| Ga0075515_100959543 | 3300006404 | Aqueous | KLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKQ* |
| Ga0099767_10226421 | 3300006644 | Activated Sludge | DKLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSFSNVPQGEG* |
| Ga0031699_1017511 | 3300006680 | Deep Ocean | MGDILPPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPLERKV* |
| Ga0031687_11155431 | 3300006688 | Deep Ocean | MGDILPPKLNINGKPIANKYCEGKMKRTLERGLKDLKPLERKEYKLAI* |
| Ga0031696_10074941 | 3300006699 | Deep Ocean | MGDILLPRLNIDGKPIANKYCEGKMKRTLERGLKDLKPLMRKE* |
| Ga0031696_12103632 | 3300006699 | Deep Ocean | MGDILLPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPFKWKV* |
| Ga0005504_12951011 | 3300006718 | Deep Ocean | MGDILLPRLNIDGKPIANKYCEGKMKRTLERGLKDLKPLKRKR* |
| Ga0075020_1167251 | 3300007159 | Watersheds | MGDKLLPRLNNVENPIVNKYCEGKMKRALKRGLKDLKPLRRKRSKLITSE* |
| Ga0075020_1170722 | 3300007159 | Watersheds | MGDKLLLRLNIYGKPIAYKYFEGKMKRTLKRGLKDLKALRRKR* |
| Ga0099776_10865722 | 3300007225 | Activated Sludge | LLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKQ* |
| Ga0075175_10282281 | 3300007228 | Wastewater Effluent | MINRDLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKR |
| Ga0079227_13628531 | 3300007342 | Marine | MGDILLPRLNIDGKPIANKYCEGKVKRTLKRGLKDLKPLERKV* |
| Ga0075022_10026051 | 3300007526 | Watersheds | MGDKLLPRLNIDENPIANKYCEGKMKRALKRGLKDLKPSRRKR* |
| Ga0102780_12077481 | 3300007599 | Marine | MGDILLPRLNMDGKPIANKYCEGKMKRTLERGLKDLKPLKRKL* |
| Ga0103911_1000023 | 3300008760 | Surface Ocean Water | MGGRLLLRLNINGKPIAYKYCEGKMKRTLKRGLKDLKSLRRKLPSGDLS* |
| Ga0103594_102671 | 3300008779 | Ocean Water | MGDILLPRLNMDGKPIANKYCEGKVKRTLRRRLKDLKPLKRKV* |
| Ga0103596_105692 | 3300008781 | Ocean Water | MQQERGGRRILRIKINGKKIADKDCEGKMKRTGKRGGKDLKSLRR |
| Ga0103482_10044871 | 3300008917 | Bay Water | LLLRLNTCGKPIANMYCEGKMKSNLKRMLKDLKPLRRKR* |
| Ga0103485_1025641 | 3300008920 | Bay Water | NICRKPIANKYCEGKMKSTLKRELEDLKSLRRKR* |
| Ga0103740_10113861 | 3300008937 | Ice Edge, Mcmurdo Sound, Antarctica | MGDILPPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPLERKVLELAN* |
| Ga0103851_10823051 | 3300009225 | River Water | KPIANKYYEGKMKRTLKRGLKDLKSLRRKAVEEK* |
| Ga0115596_10144911 | 3300009580 | Wetland | LKLNMNGNPIANKYCEGKMRRTLKRELQDLKLLRRKR* |
| Ga0115105_110069792 | 3300009679 | Marine | MGDILLPRLNMDEKPIANKYCEGKVKRTLKRGLKDLKPLKRKV* |
| Ga0123367_10684622 | 3300009757 | Marine | MGDILLPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPLKRKV* |
| Ga0127440_10662921 | 3300010100 | Grasslands Soil | RLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKQ* |
| Ga0127451_11139321 | 3300010120 | Grasslands Soil | MGDKLLIRLNTDGKTIAKKYCEGKMKRTLKRGLKDLKSLRRKR* |
| Ga0126347_14808661 | 3300010867 | Boreal Forest Soil | IYGKPIANKYCEGKMKRTLKRGLKDLKSLRRKRYK* |
| Ga0150983_110981581 | 3300011120 | Forest Soil | KLLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKR* |
| Ga0138367_10112251 | 3300011329 | Marine | MGDILLPRLNMDGKPIANKYCEGKVKRTLKRGLKDVKPLERKV* |
| Ga0134028_10060993 | 3300012224 | Grasslands Soil | LLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKQ* |
| Ga0134042_11754302 | 3300012373 | Grasslands Soil | DKLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKQ* |
| Ga0134040_10252481 | 3300012389 | Grasslands Soil | LNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKR* |
| Ga0157555_11280001 | 3300012705 | Freshwater | VLLLKLNNYEKPIANKYYEGKMKRTLKRGLKDLKSL |
| Ga0157601_11557371 | 3300012714 | Freshwater | LLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKE* |
| Ga0157600_10474121 | 3300012719 | Freshwater | LGGKLLLRLNIYWRPIAYKYCEGKMKRTLKRGLKDLKSLKRK* |
| Ga0157615_11301982 | 3300012734 | Freshwater | VGDKLLLRLTIYGKPIANKYFEGKTKRTLKRESKDMKSLRRK |
| Ga0157523_1305181 | 3300012784 | Freshwater | MGDKLLLKLNIYGKPIVSRYGEGKMKRNLKRGLKDLKALKRKQ* |
| Ga0129338_11347941 | 3300012970 | Aqueous | MGDKLLLKLNIYGISIANKDCEGKMKRTLKRGLKDLKSLKRKQ* |
| Ga0164274_1179301 | 3300013051 | Soil | MGDKLLLKLNNEYEDKENKYCEGKVKRTLKRGLKDLKSLRRKQ* |
| Ga0164284_1048142 | 3300013054 | Soil | LPIANKYCEGKVKRTLKRGLKDLKSLRRKQYKWIYV |
| Ga0164284_1063571 | 3300013054 | Soil | LLLKLNIYGKPIANKYCEGNVKRTLKRGLKDLKSLRRKQ* |
| Ga0170791_100137891 | 3300013295 | Freshwater | VGDKLLLKLNIYGKPIAYKYSDGKVKRTLKRGLKDLKLLRRKR* |
| Ga0182045_10078271 | 3300016726 | Salt Marsh | RLNMDEKPIANKYCEGKMKRTLKRGLKDLKPLRRKR |
| Ga0182052_13130401 | 3300016742 | Salt Marsh | GISLLKLNIGRRPIAIKYCEGKMKTTTKVESKELKPSSGN |
| Ga0184571_1126752 | 3300019167 | Soil | LNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKQ |
| Ga0180036_10044652 | 3300019200 | Estuarine | MNLPKLNIDGRPIAKKYCEGTMKRTLKRELKDLKSLRRKR |
| Ga0179941_10343911 | 3300019221 | Anaerobic Digestor Sludge | KLLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKRPTGIGL |
| Ga0181504_14235052 | 3300019258 | Peatland | GDKLLLKLNIYGKPIAYKYFEGKMKRTLKRGLKDLKPLRRKR |
| Ga0210303_10934191 | 3300021282 | Estuarine | LNNYEKPIANKYYEGKMKRTLKRGLKDLKSLRRKAVVG |
| Ga0210299_1641992 | 3300021284 | Estuarine | VLLLKLNNYEKPIANKYYEGKMKRTLKRGLKDLKSLRRKAV |
| Ga0206694_10184631 | 3300021291 | Seawater | MGDILPPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPLERKV |
| Ga0210306_12142521 | 3300021312 | Estuarine | NNYEKPIANKYYEGKMKRTLKRGLKDLKSLRRKAVEEK |
| Ga0210324_10701692 | 3300021333 | Estuarine | MGDKLLLRLNIYGKPIAYKYFEGKMKRTLKRGLKDLKALRRKR |
| Ga0210307_11591602 | 3300021336 | Estuarine | LGDKLLPRLNIDEKPIANKYCEGKMKRTLKRGLKDLKPLRRKR |
| Ga0206688_102243252 | 3300021345 | Seawater | MGDILLPRLNMDGKPIANKYCEGKMKRTLKRGLKDLKPLERKVLSLAIYLEMLV |
| Ga0210297_10964212 | 3300021845 | Estuarine | MLGLLLKLNNYEKPIANKYYEGKMKRTLKRGLKDLKSLRRKAV |
| Ga0210305_11160541 | 3300021847 | Estuarine | LNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKR |
| Ga0213846_10114621 | 3300021909 | Watersheds | MGDKLLLRLNKDGKPIEKKYCEGKMKRTLKRGLKDLKSLKRKR |
| Ga0213845_11986012 | 3300021929 | Watersheds | MGDKLLPRLNNVENPIVNKYCEGKMKRALKRGLKDLKPLRRKRSKLITSE |
| Ga0210310_10110953 | 3300022369 | Estuarine | LLRLNICGKPIANKYCEGQMKSTLERESKDLKPLRRKR |
| Ga0242645_10095102 | 3300022501 | Soil | KLLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKR |
| Ga0242646_10034272 | 3300022502 | Soil | ILLLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKPLRRKR |
| Ga0242647_10226802 | 3300022505 | Soil | KLLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKQ |
| Ga0242647_10303821 | 3300022505 | Soil | RLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKQ |
| Ga0222729_10639271 | 3300022507 | Soil | LRLNIYGKPIANRYCEGKMKRTLKRGVKDLKSFRRKR |
| Ga0222728_10081221 | 3300022508 | Soil | LNIYGKPIANKYCEGKMKRTLKRGLKDLKSLRRKR |
| Ga0242675_10715461 | 3300022718 | Soil | LNIYGKPIANKYCEVKMKRTLKRESKDLKSLRRKR |
| Ga0228706_10221531 | 3300023697 | Freshwater | INGKPIANKYCEGKMKRTLKRGLKDLKSLRRKAVEEK |
| Ga0228706_10303681 | 3300023697 | Freshwater | NIYGKPIANKYYEGKMKRTLKRGLKDLKSLRRKAVEEK |
| Ga0228708_10385141 | 3300023703 | Freshwater | LLRLNIYRRPIAYKYCEGKMKRTLKRGLKDLKSLKRKR |
| Ga0228709_10364202 | 3300023708 | Freshwater | NGKPIANKYCEGKMKRTLKRGLKDLKSLRRKAVEEK |
| Ga0228709_11001642 | 3300023708 | Freshwater | VGDKLLLKLNIYGKPIAYKYSDGKVKRTLKRGLKDLKLLRRKR |
| Ga0255278_10578891 | 3300024859 | Freshwater | LKLNTNGRLIANKDCEGKMKRTLKRVIKQGLKLLRGKALETNRA |
| Ga0255271_10871501 | 3300024864 | Freshwater | NINGKPIANKYCEGKMKRTLKRGLKDLKSLRRKAVEEK |
| Ga0256296_10169551 | 3300026405 | Freshwater | MVDKLLLKLNNYEKPIANKYYEGKMKTTLKRGLKDLKSLRRKAVEEK |
| Ga0247569_10036461 | 3300026421 | Seawater | MGYKLLLKLNIYGRQIANKYSEVKMKRTLKRGLKDLKSLRRNW |
| Ga0247600_10261501 | 3300026461 | Seawater | MGDILLPRLNIYENPIANKYCEGKMKRTLERGLKDLKLLVRK |
| Ga0247568_10935741 | 3300026462 | Seawater | KQNLKRNIIIKPIANRYSEGKMKSTLEIELKDLKTLRRKR |
| Ga0257142_10527332 | 3300028621 | Marine | MGYKLLLRLNIDVRPIANKYCEGKIKRTLKRGLKDVKSLRRKL |
| Ga0210252_100646861 | 3300030548 | Soil | SGDILLLRLNIYRRPIAYKYCEGKMKRTIKWSEKILK |
| Ga0308137_10656492 | 3300030722 | Marine | MGDILLPRLNMDGKPIANKYCEGKLIRTLIRGLKDLKPLERKV |
| Ga0315894_1039421 | 3300030769 | Plant Litter | MGDKLLLRLNIDGKPIATKYGEGPMKRTLKRGLKDLKSLRRKR |
| Ga0102757_100670721 | 3300030785 | Soil | KPIANKYCEGKMKRTLKRGLKDLKSLKRKRKRWIT |
| Ga0265790_1190671 | 3300030792 | Plant Litter | MGDKILLRLNIYVKPIENKYCEGKFKRTFKRGLKDLKSLRRKQ |
| Ga0265729_1015692 | 3300030816 | Soil | MGDKLLLNLNIYGKPIAYKYFEGKMKRTLKRGLKDLKALRRKR |
| Ga0315872_1102041 | 3300030820 | Plant Litter | MGDKLLLRINIYGKQIANFYCEGKVILTLNRGLKDLKSLRRKQYKWI |
| Ga0315851_1181961 | 3300030822 | Plant Litter | MGDQLLLRLNIYGKPIANKYGEGKVKRPLKRALKDLKTLRRKQ |
| Ga0315870_1054192 | 3300030823 | Plant Litter | LLNLNIYVKPIANMYCEVKMKRTLKRGLKDFKSLKRKR |
| Ga0315875_1138361 | 3300030890 | Plant Litter | MGDKLLIRLNIYGKKIAKNYFEGKVKRTLKRLLKEFKSLRRKQYKWI |
| Ga0315859_1123211 | 3300030896 | Plant Litter | MVDKLLLRLKIDGKPIANKYCEGKMKITLKRGLKDLKSLRRKR |
| Ga0315873_1130301 | 3300030927 | Plant Litter | MGDKLLLRLKIYGKPIAKNYCEGKEKRTLKRGLKDLKSLRRKQ |
| Ga0073974_10023221 | 3300031005 | Marine | MGDILLPRLNMDGKPIANKYCEGKMKRTLKRGLKDLKPLERKVLSLAIYSETLV |
| Ga0073973_17287231 | 3300031006 | Marine | MGDILLPRLNMDGKPIANKYCEGKMKRTLKRGLKDLKPLERKVLSLAICSETLV |
| Ga0315862_1066362 | 3300031026 | Plant Litter | MGYKLLLRLNIYGKPIANKYREGKVKRTLKRGKKDLKSLRRKQ |
| Ga0315844_1163792 | 3300031061 | Plant Litter | MGDKLLRRLNIDGKPIANKYSEGQEKRTLKRGLKDLKSLRRKQ |
| Ga0315846_1016381 | 3300031069 | Plant Litter | MGDKLLLRLNIDGKPIANKYCEVKMKITLKRGLKDLKSLRRKR |
| Ga0315843_1146671 | 3300031079 | Plant Litter | PQKLIISQNNYLKPIANKNCEGKVKTTLKRGLKDLKSLRRKQ |
| Ga0315841_1068132 | 3300031101 | Plant Litter | MGVKLLLRLNIYGKPIANKYCEGKVKITLKRGLKDLKSLRRKQ |
| Ga0315814_1155221 | 3300031130 | Plant Litter | MGDNLLLRLNIYGKPIANKYSEGKVKRKFKIGLKYMKSFRRKQ |
| Ga0315835_1096051 | 3300031426 | Plant Litter | MGDKLLLRLNIDGKPIANKYCEVKMKTKLKRGIKDLKSLRRKR |
| Ga0315832_1074751 | 3300031428 | Plant Litter | MQPKMAKKLLKSLKIYGKPISNKYSEGNVKRTLKRGLKYLKSLRRKQ |
| Ga0316035_1115072 | 3300031955 | Soil | LLLRLNIYGKPIANKYCEGKVKRTLKRGLKDLKSLRRKQ |
| Ga0214502_10513101 | 3300032514 | Switchgrass Phyllosphere | KLLPRLNIDEKPIANKYCDGKMKRALKRGLKDSKPLK |
| Ga0348332_136259922 | 3300032515 | Plant Litter | LNIYGKPIANKYYEGKMKRTLKRGLKDLKSLIRKAVEEK |
| Ga0321338_10900793 | 3300032593 | Switchgrass Phyllosphere | MGDKLLLSLNNYVKPIANNNYEGKVKRTLKRGLKDLKSLRRKQ |
| Ga0321338_12073831 | 3300032593 | Switchgrass Phyllosphere | GDKLLPRLNIDEKPIANKYCEGKMKRALKRGLKDLKPLKWKE |
| Ga0314681_105722831 | 3300032711 | Seawater | KLLLRLNICGKPIANKYCEGKMKSTLERESKDLKPLRRKR |
| Ga0314768_11034571 | 3300033523 | Switchgrass Phyllosphere | MGDKLLLRLNIYGKTIENKYCEGKVKRTLKRGLKDLKSLRRKQ |
| Ga0314760_11353231 | 3300033530 | Switchgrass Phyllosphere | LNIDGKPIANKYCEGKMKRTLKRGLKDLKSLRRKR |
| Ga0314767_11583841 | 3300033532 | Switchgrass Phyllosphere | MGDKLLLRLNIYGKTIAKKYCEGKVKRTLKRGLKDLKSLRRKR |
| Ga0314803_030915_1_108 | 3300034678 | Soil | LNIYGKPIANKYCEGKMKRTLKRELKDLKSLRRKR |
| ⦗Top⦘ |