| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006680 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092433 | Ga0031699 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2966 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 34739842 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma floridae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South of Funchal, North Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 32.08 | Long. (o) | -17.27 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064647 | Metatranscriptome | 128 | Y |
| F065812 | Metagenome / Metatranscriptome | 127 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031699_101751 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 604 | Open in IMG/M |
| Ga0031699_173585 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma floridae | 527 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031699_101751 | Ga0031699_1017511 | F065812 | MGDILPPRLNMDGKPIANKYCEGKVKRTLKRGLKDLKPLERKV* |
| Ga0031699_173585 | Ga0031699_1735851 | F064647 | MAADLSFSDLLLSPEADDELQEAFNAFSGGAAEVPEDKLGDILAGMGIKPTKDELDDMVARAGDKGGKIDFKGFKTMITTRATTPKDEKDLMAALTYFAEDGKIDCGKLVGAMIGFNEAADADDMKRFKKANGSSIDVQELYLKVTEV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |