


| Basic Information | |
|---|---|
| Family ID | F051532 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KYEEELAEDIMKILTCYSARFYGARGGRKKKNKAENEPNESNGI |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.28 % |
| % of genes near scaffold ends (potentially truncated) | 74.31 % |
| % of genes from short scaffolds (< 2000 bps) | 77.78 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 6.25 |
| PF00436 | SSB | 2.78 |
| PF05869 | Dam | 2.78 |
| PF05063 | MT-A70 | 2.08 |
| PF12705 | PDDEXK_1 | 1.39 |
| PF01381 | HTH_3 | 1.39 |
| PF12635 | DUF3780 | 1.39 |
| PF00176 | SNF2-rel_dom | 1.39 |
| PF02867 | Ribonuc_red_lgC | 1.39 |
| PF13481 | AAA_25 | 0.69 |
| PF02511 | Thy1 | 0.69 |
| PF00149 | Metallophos | 0.69 |
| PF05866 | RusA | 0.69 |
| PF04055 | Radical_SAM | 0.69 |
| PF00521 | DNA_topoisoIV | 0.69 |
| PF13439 | Glyco_transf_4 | 0.69 |
| PF02945 | Endonuclease_7 | 0.69 |
| PF00535 | Glycos_transf_2 | 0.69 |
| PF00145 | DNA_methylase | 0.69 |
| PF13155 | Toprim_2 | 0.69 |
| PF12728 | HTH_17 | 0.69 |
| PF00115 | COX1 | 0.69 |
| PF14279 | HNH_5 | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF14354 | Lar_restr_allev | 0.69 |
| PF06067 | DUF932 | 0.69 |
| PF07505 | DUF5131 | 0.69 |
| PF03354 | TerL_ATPase | 0.69 |
| PF02498 | Bro-N | 0.69 |
| PF01695 | IstB_IS21 | 0.69 |
| PF00154 | RecA | 0.69 |
| PF05766 | NinG | 0.69 |
| PF01653 | DNA_ligase_aden | 0.69 |
| PF03721 | UDPG_MGDP_dh_N | 0.69 |
| PF12684 | DUF3799 | 0.69 |
| PF00692 | dUTPase | 0.69 |
| PF00574 | CLP_protease | 0.69 |
| PF09723 | Zn-ribbon_8 | 0.69 |
| PF12850 | Metallophos_2 | 0.69 |
| PF04308 | RNaseH_like | 0.69 |
| PF09511 | RNA_lig_T4_1 | 0.69 |
| PF01972 | SDH_sah | 0.69 |
| PF01139 | RtcB | 0.69 |
| PF04973 | NMN_transporter | 0.69 |
| PF08774 | VRR_NUC | 0.69 |
| PF09588 | YqaJ | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.25 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.25 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.25 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 4.17 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.78 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.78 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.78 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.39 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.39 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.69 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.69 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.69 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.69 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.69 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.69 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.69 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.69 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.69 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.69 |
| COG3617 | Prophage antirepressor | Mobilome: prophages, transposons [X] | 0.69 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.69 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.69 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.17 % |
| All Organisms | root | All Organisms | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2027040001|EFn_FUOFX6F02F3WE4 | Not Available | 517 | Open in IMG/M |
| 2027040003|ASn_FUOFX6F01DK2PF | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Helicobacteraceae → Helicobacter → Helicobacter pylori | 518 | Open in IMG/M |
| 2070309005|IF_singleton_cluster_17725 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 512 | Open in IMG/M |
| 3300000558|Draft_11525334 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300001335|ML8_10098839 | Not Available | 940 | Open in IMG/M |
| 3300001336|ML7_10080365 | Not Available | 1452 | Open in IMG/M |
| 3300001533|MLSed_10000620 | Not Available | 36070 | Open in IMG/M |
| 3300001533|MLSed_10002966 | Not Available | 36187 | Open in IMG/M |
| 3300001533|MLSed_10057842 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
| 3300001533|MLSed_10066008 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
| 3300001533|MLSed_10244108 | Not Available | 674 | Open in IMG/M |
| 3300005512|Ga0074648_1142538 | Not Available | 742 | Open in IMG/M |
| 3300005664|Ga0073685_1050194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1165 | Open in IMG/M |
| 3300005915|Ga0075122_10279208 | Not Available | 564 | Open in IMG/M |
| 3300005918|Ga0075116_10045022 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M8B2D | 1835 | Open in IMG/M |
| 3300005935|Ga0075125_10004228 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 6915 | Open in IMG/M |
| 3300005939|Ga0075123_10008527 | Not Available | 4415 | Open in IMG/M |
| 3300005939|Ga0075123_10213193 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300007029|Ga0102677_101432 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300007363|Ga0075458_10041666 | Not Available | 1450 | Open in IMG/M |
| 3300007516|Ga0105050_10354272 | Not Available | 886 | Open in IMG/M |
| 3300007523|Ga0105052_10555140 | Not Available | 739 | Open in IMG/M |
| 3300007623|Ga0102948_1013711 | All Organisms → Viruses → Predicted Viral | 2798 | Open in IMG/M |
| 3300009149|Ga0114918_10003941 | Not Available | 12987 | Open in IMG/M |
| 3300009149|Ga0114918_10576672 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 596 | Open in IMG/M |
| 3300009295|Ga0103747_10065371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 898 | Open in IMG/M |
| 3300009664|Ga0116146_1127120 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300009666|Ga0116182_1380981 | Not Available | 560 | Open in IMG/M |
| 3300009669|Ga0116148_1019736 | All Organisms → cellular organisms → Bacteria | 4483 | Open in IMG/M |
| 3300009669|Ga0116148_1376643 | Not Available | 565 | Open in IMG/M |
| 3300009674|Ga0116173_1271999 | Not Available | 766 | Open in IMG/M |
| 3300009676|Ga0116187_1417795 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 584 | Open in IMG/M |
| 3300009682|Ga0116172_10349497 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 708 | Open in IMG/M |
| 3300009688|Ga0116176_10003916 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 10942 | Open in IMG/M |
| 3300009688|Ga0116176_10039960 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
| 3300009693|Ga0116141_10129145 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1469 | Open in IMG/M |
| 3300009693|Ga0116141_10509389 | Not Available | 606 | Open in IMG/M |
| 3300009713|Ga0116163_1209609 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 680 | Open in IMG/M |
| 3300009715|Ga0116160_1106821 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin101 | 1195 | Open in IMG/M |
| 3300009768|Ga0116193_1118121 | Not Available | 1198 | Open in IMG/M |
| 3300009780|Ga0116156_10117408 | Not Available | 1524 | Open in IMG/M |
| 3300010344|Ga0116243_10764824 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 565 | Open in IMG/M |
| 3300010345|Ga0116253_10268861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin072 | 1097 | Open in IMG/M |
| 3300010345|Ga0116253_10700167 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 607 | Open in IMG/M |
| 3300010346|Ga0116239_10952948 | Not Available | 529 | Open in IMG/M |
| 3300010347|Ga0116238_10006344 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 16623 | Open in IMG/M |
| 3300010347|Ga0116238_10106454 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
| 3300010351|Ga0116248_10485429 | Not Available | 910 | Open in IMG/M |
| 3300010351|Ga0116248_10591395 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010353|Ga0116236_10007878 | All Organisms → cellular organisms → Bacteria | 14769 | Open in IMG/M |
| 3300010353|Ga0116236_10328961 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300010353|Ga0116236_10432103 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300010353|Ga0116236_10620092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFOXYC12_FULL_60_6 | 888 | Open in IMG/M |
| 3300010357|Ga0116249_10134752 | All Organisms → Viruses → Predicted Viral | 2315 | Open in IMG/M |
| 3300010357|Ga0116249_10369154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Schitoviridae → Enquatrovirinae → Gamaleyavirus | 1323 | Open in IMG/M |
| 3300010410|Ga0136992_10050123 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 690 | Open in IMG/M |
| 3300010411|Ga0136993_10026241 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300010411|Ga0136993_10074082 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 701 | Open in IMG/M |
| 3300010429|Ga0116241_10049014 | Not Available | 3934 | Open in IMG/M |
| 3300011118|Ga0114922_11232808 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 604 | Open in IMG/M |
| 3300012956|Ga0154020_10370662 | Not Available | 1238 | Open in IMG/M |
| 3300013088|Ga0163200_1149482 | Not Available | 719 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1339852 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 529 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10868236 | Not Available | 506 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10118854 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10205261 | Not Available | 1321 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10615207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Candidatus Desulforudis → unclassified Candidatus Desulforudis → Candidatus Desulforudis sp. | 686 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10227380 | Not Available | 1344 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10733320 | Not Available | 661 | Open in IMG/M |
| 3300014204|Ga0172381_10311285 | Not Available | 1246 | Open in IMG/M |
| 3300014206|Ga0172377_10168822 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300014206|Ga0172377_10838107 | Not Available | 719 | Open in IMG/M |
| 3300014613|Ga0180008_1057684 | Not Available | 1546 | Open in IMG/M |
| 3300014613|Ga0180008_1105861 | Not Available | 1100 | Open in IMG/M |
| 3300014613|Ga0180008_1390158 | Not Available | 525 | Open in IMG/M |
| 3300014656|Ga0180007_10010819 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 8051 | Open in IMG/M |
| 3300014656|Ga0180007_10192147 | Not Available | 1302 | Open in IMG/M |
| 3300015214|Ga0172382_10158614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1939 | Open in IMG/M |
| 3300017963|Ga0180437_10636503 | Not Available | 777 | Open in IMG/M |
| 3300017971|Ga0180438_10035423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5009 | Open in IMG/M |
| 3300017987|Ga0180431_10033560 | Not Available | 4899 | Open in IMG/M |
| 3300017987|Ga0180431_10520806 | Not Available | 826 | Open in IMG/M |
| 3300017989|Ga0180432_10037053 | Not Available | 4769 | Open in IMG/M |
| 3300017989|Ga0180432_10782529 | Not Available | 663 | Open in IMG/M |
| 3300017989|Ga0180432_11163204 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 518 | Open in IMG/M |
| 3300017991|Ga0180434_10006601 | Not Available | 13290 | Open in IMG/M |
| 3300017991|Ga0180434_11289136 | Not Available | 546 | Open in IMG/M |
| 3300018080|Ga0180433_10361667 | Not Available | 1128 | Open in IMG/M |
| 3300018080|Ga0180433_10414849 | Not Available | 1037 | Open in IMG/M |
| 3300018080|Ga0180433_10897982 | Not Available | 650 | Open in IMG/M |
| 3300022858|Ga0222679_1039373 | Not Available | 836 | Open in IMG/M |
| 3300022858|Ga0222679_1068670 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 576 | Open in IMG/M |
| 3300022860|Ga0222698_1031979 | Not Available | 1006 | Open in IMG/M |
| 3300022874|Ga0222685_1052321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 757 | Open in IMG/M |
| 3300022887|Ga0222642_1091360 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae | 561 | Open in IMG/M |
| 3300022890|Ga0222667_1063506 | Not Available | 675 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10028724 | Not Available | 1609 | Open in IMG/M |
| 3300023434|Ga0222680_1004317 | Not Available | 3222 | Open in IMG/M |
| 3300023434|Ga0222680_1075031 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300023435|Ga0222637_1062129 | Not Available | 696 | Open in IMG/M |
| (restricted) 3300024256|Ga0233446_1074244 | Not Available | 1064 | Open in IMG/M |
| 3300025306|Ga0208045_1107413 | Not Available | 600 | Open in IMG/M |
| 3300025661|Ga0208905_1023255 | Not Available | 2308 | Open in IMG/M |
| 3300025689|Ga0209407_1007530 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 7779 | Open in IMG/M |
| 3300025698|Ga0208771_1102741 | Not Available | 811 | Open in IMG/M |
| 3300025706|Ga0209507_1112204 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7 | 755 | Open in IMG/M |
| 3300025708|Ga0209201_1032364 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus → Algoriphagus formosus | 2437 | Open in IMG/M |
| 3300025714|Ga0208458_1174371 | Not Available | 694 | Open in IMG/M |
| 3300025736|Ga0207997_1067874 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300025736|Ga0207997_1115598 | Not Available | 880 | Open in IMG/M |
| 3300025736|Ga0207997_1138651 | Not Available | 778 | Open in IMG/M |
| 3300025861|Ga0209605_1058280 | Not Available | 1687 | Open in IMG/M |
| 3300025866|Ga0208822_1002881 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 10679 | Open in IMG/M |
| 3300027976|Ga0209702_10186813 | Not Available | 891 | Open in IMG/M |
| 3300028168|Ga0268277_1082331 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 859 | Open in IMG/M |
| 3300028191|Ga0265595_1139360 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 756 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1149213 | Not Available | 958 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1164502 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 899 | Open in IMG/M |
| 3300028572|Ga0302152_10190468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1030146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3327 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1155872 | Not Available | 994 | Open in IMG/M |
| 3300028602|Ga0265294_10253471 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300028603|Ga0265293_10177336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1513 | Open in IMG/M |
| 3300028629|Ga0302248_1061001 | Not Available | 872 | Open in IMG/M |
| 3300028920|Ga0272441_10694606 | Not Available | 800 | Open in IMG/M |
| 3300029171|Ga0168034_102963 | Not Available | 1395 | Open in IMG/M |
| 3300030507|Ga0302192_10014069 | Not Available | 4716 | Open in IMG/M |
| 3300031566|Ga0307378_10429899 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1204 | Open in IMG/M |
| 3300031669|Ga0307375_10180037 | Not Available | 1438 | Open in IMG/M |
| 3300031673|Ga0307377_10758124 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 676 | Open in IMG/M |
| 3300031707|Ga0315291_10014094 | All Organisms → cellular organisms → Bacteria | 9689 | Open in IMG/M |
| 3300031746|Ga0315293_10072745 | Not Available | 2950 | Open in IMG/M |
| 3300031834|Ga0315290_10292301 | Not Available | 1426 | Open in IMG/M |
| 3300031885|Ga0315285_10274640 | Not Available | 1283 | Open in IMG/M |
| 3300031999|Ga0315274_10090891 | Not Available | 3990 | Open in IMG/M |
| 3300032018|Ga0315272_10227170 | Not Available | 894 | Open in IMG/M |
| 3300032163|Ga0315281_10458636 | Not Available | 1363 | Open in IMG/M |
| 3300032164|Ga0315283_11208283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NZP2298 | 789 | Open in IMG/M |
| 3300032173|Ga0315268_10297818 | Not Available | 1561 | Open in IMG/M |
| 3300032397|Ga0315287_10075501 | Not Available | 3774 | Open in IMG/M |
| 3300032397|Ga0315287_10430631 | Not Available | 1565 | Open in IMG/M |
| 3300032397|Ga0315287_11191083 | Not Available | 877 | Open in IMG/M |
| 3300032516|Ga0315273_11561150 | Not Available | 808 | Open in IMG/M |
| 3300033171|Ga0334895_1094132 | Not Available | 833 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 25.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 13.19% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 8.33% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 7.64% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 5.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.47% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 3.47% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 3.47% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.08% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.08% |
| Aquatic | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.08% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.39% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.39% |
| Benthic Lake | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake | 0.69% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.69% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.69% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.69% |
| Wetlands Benthic | Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic | 0.69% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.69% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 0.69% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.69% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.69% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.69% |
| Hypersaline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypersaline Water | 0.69% |
| Aquarium Water | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water | 0.69% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.69% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.69% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.69% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Wastewater | 0.69% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater | 0.69% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater | 0.69% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 0.69% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2027040001 | Viral communities in wastewater treatment process (EF-no assembly) | Engineered | Open in IMG/M |
| 2027040003 | Viral communities in wastewater treatment process (AS-no assmebly) | Engineered | Open in IMG/M |
| 2070309005 | Wastewater viral communities from wastewater treatment facility in Singapore - IF-deduplicated data | Engineered | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001335 | Wetlands benthic microbial communities from British Columbia, Canada - ML8 | Environmental | Open in IMG/M |
| 3300001336 | ML7 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300005915 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKB | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300005935 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN | Environmental | Open in IMG/M |
| 3300005939 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX | Environmental | Open in IMG/M |
| 3300007029 | Non-marine hypersaline water viral communities from A?ana, Logro?o,Spain - Vir_A?ana_3_PRE | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010410 | Aquatic microbial communities from North Sea petroleum storage tank - Cell4b | Environmental | Open in IMG/M |
| 3300010411 | Aquatic microbial communities from North Sea petroleum storage tank - Cell3b | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300014613 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG | Environmental | Open in IMG/M |
| 3300014656 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG | Environmental | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300022858 | Saline water microbial communities from Ace Lake, Antarctica - #939 | Environmental | Open in IMG/M |
| 3300022860 | Saline water microbial communities from Ace Lake, Antarctica - #1450 | Environmental | Open in IMG/M |
| 3300022874 | Saline water microbial communities from Ace Lake, Antarctica - #1077 | Environmental | Open in IMG/M |
| 3300022887 | Saline water microbial communities from Ace Lake, Antarctica - #229 | Environmental | Open in IMG/M |
| 3300022890 | Saline water microbial communities from Ace Lake, Antarctica - #657 | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023434 | Saline water microbial communities from Ace Lake, Antarctica - #1004 | Environmental | Open in IMG/M |
| 3300023435 | Saline water microbial communities from Ace Lake, Antarctica - #143 | Environmental | Open in IMG/M |
| 3300024256 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MG | Environmental | Open in IMG/M |
| 3300025306 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m (SPAdes) | Environmental | Open in IMG/M |
| 3300025661 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes) | Environmental | Open in IMG/M |
| 3300025689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025736 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN (SPAdes) | Environmental | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028168 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028629 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Leu | Engineered | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300029171 | Aquariaum water viral communities from Chicago, USA - Great Lakes - GLA2 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033171 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_05-R3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| EF_na_1817030 | 2027040001 | Wastewater | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENESVEI |
| AS_na_921880 | 2027040003 | Wastewater | EEELAEDIMKILTCYSARYYGARGGRKKKIKIENEPVESNGI |
| IF_00824970 | 2070309005 | Wastewater | EKKYEEELAEDIMKILTCYSARFYGARGGRKKKNVAENEPNESDGI |
| Draft_115253341 | 3300000558 | Hydrocarbon Resource Environments | YEDELAEDIMKILTCYSARYYGARGGRKKKNQAENMPVESNGI* |
| ML8_100988393 | 3300001335 | Wetlands Benthic | MEKKEKKYEEELAEDIMKILTCYSARFYGARGGRKKKNKTENEPDESNGI* |
| ML7_100803653 | 3300001336 | Benthic Lake | MKIPTCYSAKYYGAGGGRKKKNQAENTPVESNGI* |
| MLSed_1000062035 | 3300001533 | Benthic | VYNKGVGYEEELAEDIMKILTCYSAKYYGARGGRKKKNQVENIPVESNRI* |
| MLSed_100029665 | 3300001533 | Benthic | VEKKEKKYEEELAEDIMKILTCYSARFYGARGGRKKKNKTENEPDESNGI* |
| MLSed_100578421 | 3300001533 | Benthic | DIMKILTRYSAKYYGARGGRKKKNQAENTPVESNGI* |
| MLSed_100660084 | 3300001533 | Benthic | MKILTCYSARYYGARGGRKKKNQAENTPVESNGI* |
| MLSed_102441081 | 3300001533 | Benthic | LDAIFTNLEIEVEIMETKEKKYEEELAEDIMKILTCYSARYYGVRGGRKKKNQAENTPVESNGI* |
| Ga0074648_11425381 | 3300005512 | Saline Water And Sediment | IMKILTCYSARYYGARGGRKKKNKAENEPVESNGI* |
| Ga0073685_10501942 | 3300005664 | Aquatic | VEIKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIEPINEPNESNGI* |
| Ga0075122_102792081 | 3300005915 | Saline Lake | IVEAKEQKYEEELAEDIMKILTCYSARYYGRRGGRKKKNQTVESNGI* |
| Ga0075116_100450224 | 3300005918 | Saline Lake | AEDIMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI* |
| Ga0075125_1000422817 | 3300005935 | Saline Lake | KEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI* |
| Ga0075123_100085271 | 3300005939 | Saline Lake | NLEVTVEIVELKEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI* |
| Ga0075123_102131931 | 3300005939 | Saline Lake | IMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI* |
| Ga0102677_1014321 | 3300007029 | Hypersaline Water | AEDIMKILTCYSARFYGRRGGRKKKNTAENEPNESNGI* |
| Ga0075458_100416661 | 3300007363 | Aqueous | EKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENESVESNGI* |
| Ga0105050_103542721 | 3300007516 | Freshwater | AEDIMKILTCYSARYYGRRGGIKKKNTEKNQNIESNGI* |
| Ga0105052_105551404 | 3300007523 | Freshwater | MKILTCYSARYYGRRGGRKKKNTEKNQNIESNGI* |
| Ga0102948_10137115 | 3300007623 | Water | MKILTCYSARFYGARGGRKKKNKAENEPNESNGI* |
| Ga0114918_1000394110 | 3300009149 | Deep Subsurface | MKILTCYSARFYGRRGGRKKKNTAENESVESNGI* |
| Ga0114918_105766721 | 3300009149 | Deep Subsurface | IMKILTCYSARFYGRRGGRKKKNKAENEDNESNGI* |
| Ga0103747_100653711 | 3300009295 | Wastewater Sludge | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKNKDENEPVESN* |
| Ga0116146_11271201 | 3300009664 | Anaerobic Digestor Sludge | EDIMKILTCYSARFYGARGGRKKKNKAENEPDESNGI* |
| Ga0116182_13809812 | 3300009666 | Anaerobic Digestor Sludge | IMKILTCYSARYYGARGGRKKKIIQEIPLVESDGI* |
| Ga0116148_10197361 | 3300009669 | Anaerobic Digestor Sludge | VEIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENMPVESNGI* |
| Ga0116148_13766431 | 3300009669 | Anaerobic Digestor Sludge | LAEDIMKILTCYSARFYGRRGGRKKKIKVENEPDESNGI* |
| Ga0116173_12719992 | 3300009674 | Anaerobic Digestor Sludge | MKIYKITCYSARYYGARGGRKKKNQVENIPGESNGI* |
| Ga0116187_14177952 | 3300009676 | Anaerobic Digestor Sludge | DIMKILTCYSARFYGRRGGRKKKNTAENTPVESNGI* |
| Ga0116172_103494971 | 3300009682 | Anaerobic Digestor Sludge | DIMKILTCYSARFYGRRGGRKKKNTAENEPIESNGI* |
| Ga0116176_100039161 | 3300009688 | Anaerobic Digestor Sludge | DTKERKYEEELAEDIMKILTCYSAKYYGARGGRKKKIAVVESNAIQ* |
| Ga0116176_100399606 | 3300009688 | Anaerobic Digestor Sludge | MKILTCYSARFYGRRGGRKKKNTAENEPIESNGI* |
| Ga0116141_101291451 | 3300009693 | Anaerobic Digestor Sludge | MKILTCYSARYYGARGGRKKKIKVENESVESNGI* |
| Ga0116141_105093893 | 3300009693 | Anaerobic Digestor Sludge | FSNLEIQVEVMEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKNKAENEPVESNGI |
| Ga0116163_12096092 | 3300009713 | Anaerobic Digestor Sludge | MKILTCYSARFYSARGGRKKKNKGENEPNESNGI* |
| Ga0116160_11068211 | 3300009715 | Anaerobic Digestor Sludge | KEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIIQEIPLVESDGI* |
| Ga0116193_11181212 | 3300009768 | Anaerobic Digestor Sludge | MKIYKITEARYYGTRVGRKKKNQAENDPVESNGI* |
| Ga0116156_101174082 | 3300009780 | Anaerobic Digestor Sludge | MKIYKITVEIMEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI |
| Ga0116243_107648243 | 3300010344 | Anaerobic Digestor Sludge | EELAEDIMKILTCYSARFYGRRGGRKKKNKAENEPNESNGI* |
| Ga0116253_102688615 | 3300010345 | Anaerobic Digestor Sludge | VVETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENESVESNGI* |
| Ga0116253_107001672 | 3300010345 | Anaerobic Digestor Sludge | YEEELAEDIMKILTCYSARFYGRRGGRKKKNTAENTPVESNGI* |
| Ga0116239_109529483 | 3300010346 | Anaerobic Digestor Sludge | KEKKYEEELAEDIMKILTCYSARYYGTRGGRKKKNQAENEPVESNGI* |
| Ga0116238_1000634418 | 3300010347 | Anaerobic Digestor Sludge | AEDIMKILTCYSARFYGRRGGRKKKNTVENESNESNGI* |
| Ga0116238_101064541 | 3300010347 | Anaerobic Digestor Sludge | AMDIMKILTCYSARFYGARGGRKKKNKAENEPDESNGI* |
| Ga0116248_104854291 | 3300010351 | Anaerobic Digestor Sludge | KEKKYEEELAEDIMKILTCYSARFYGARGGRKKKNKAENEPVESNGI* |
| Ga0116248_105913954 | 3300010351 | Anaerobic Digestor Sludge | IMKILTCYSARYYGARGGRKKKIKVENEPVESNGI* |
| Ga0116236_100078781 | 3300010353 | Anaerobic Digestor Sludge | LAEDIMKILTCYSARFYGRRGGRKKKNTAENEPIESNGI* |
| Ga0116236_103289615 | 3300010353 | Anaerobic Digestor Sludge | DIMKILTCYSARFYGRRGGRKKKIKVENEPDESNGI* |
| Ga0116236_104321033 | 3300010353 | Anaerobic Digestor Sludge | VKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI* |
| Ga0116236_106200921 | 3300010353 | Anaerobic Digestor Sludge | IMKILTCYSARYYGARGGRKKKIKVENESVESNGI* |
| Ga0116249_101347528 | 3300010357 | Anaerobic Digestor Sludge | AEDIMKILTCYSARYYGARGGRKKKIKVENKPVESNGI* |
| Ga0116249_103691543 | 3300010357 | Anaerobic Digestor Sludge | IMKILTCYSARYYGARGGRKKKNQAENMPVESNGI* |
| Ga0136992_100501232 | 3300010410 | Aquatic | MKILTCYSARFYGRRGGRKKKNTTENESNESNGI* |
| Ga0136993_100262416 | 3300010411 | Aquatic | DIMKILTCYSARFYGRRGGRKKKNVAENEPVESNGI* |
| Ga0136993_100740822 | 3300010411 | Aquatic | KEKKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTAENEPDESNGI* |
| Ga0116241_1004901410 | 3300010429 | Anaerobic Digestor Sludge | VIDTKERKYEEELAEDIMKILTCYSARYYGARGGRKKKIEVVESNAIK* |
| Ga0114922_112328081 | 3300011118 | Deep Subsurface | YEEELAEDIMKILTCYSARFYGRRGGRKKKNTAENEPVESNGI* |
| Ga0154020_103706621 | 3300012956 | Active Sludge | LDAIFRNLEIIVEIVEIKEKKYEDELAEDIMKILTCYSARYYGARGGRKKKIEPINEPNESNGI* |
| Ga0163200_11494822 | 3300013088 | Freshwater | METKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI* |
| (restricted) Ga0172374_13398522 | 3300013122 | Freshwater | AEDIMKILTCYSARYYGARGGRKKKNEQQNEPNESNGI* |
| (restricted) Ga0172365_108682363 | 3300013127 | Sediment | AIFSNLEIQVEVMEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKNKTENESVEFNGI* |
| (restricted) Ga0172364_101188543 | 3300013129 | Sediment | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKAENEPIESNGI* |
| (restricted) Ga0172364_102052612 | 3300013129 | Sediment | MKIYKITREISKIIEASEFMKILTCYSARYYGARGGRKKKNKAENEPVESHGI* |
| (restricted) Ga0172363_106152072 | 3300013130 | Sediment | YEEELAEDIMKILTCYSARFYGARGVRKKKNKAENESIEFNGI* |
| (restricted) Ga0172362_102273804 | 3300013133 | Sediment | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKNKAENEPVESNEI* |
| (restricted) Ga0172362_107333201 | 3300013133 | Sediment | MKILTCYSARYYGARGGRKKKNKAENEPIESNGI* |
| Ga0172381_103112851 | 3300014204 | Landfill Leachate | MKKNYMKILTCYSARYYGARGGRKKKNKTENEPVES |
| Ga0172377_101688224 | 3300014206 | Landfill Leachate | MKKNYMKILTCYSARYYGARGGRKKKNKTENEPVESNGI* |
| Ga0172377_108381071 | 3300014206 | Landfill Leachate | NLEIEVEIMETKEKKYKEELAEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI* |
| Ga0180008_10576841 | 3300014613 | Groundwater | TVEIMEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI* |
| Ga0180008_11058611 | 3300014613 | Groundwater | VEIVETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIEVSESNGI* |
| Ga0180008_13901582 | 3300014613 | Groundwater | EIVEIKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIEPINEPNESNGI* |
| Ga0180007_1001081912 | 3300014656 | Groundwater | VEVKDKKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTAENEPNDSNGI* |
| Ga0180007_101921475 | 3300014656 | Groundwater | ELAEDIMKILTCYSARYYGARGGRKKKIEVVESNAI* |
| Ga0172382_101586144 | 3300015214 | Landfill Leachate | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENELVESNGI* |
| Ga0180437_106365032 | 3300017963 | Hypersaline Lake Sediment | AEDIMKILTCYSARFYGARGGRKKKNKIENETSESNGI |
| Ga0180438_100354235 | 3300017971 | Hypersaline Lake Sediment | DIMKILTCYSARFYGARGGRKKKNKAENESGESNGI |
| Ga0180431_100335601 | 3300017987 | Hypersaline Lake Sediment | EDIMKILTCYSARFYGARGGRKKKNKLENETSESNGI |
| Ga0180431_105208063 | 3300017987 | Hypersaline Lake Sediment | DIMKILTCYSARFYGARGGRKKKNKIENETSESNGI |
| Ga0180432_1003705316 | 3300017989 | Hypersaline Lake Sediment | AEDIMKILTCYSARFYGARGGRKKKNKLENETSESNGI |
| Ga0180432_107825291 | 3300017989 | Hypersaline Lake Sediment | ELAEDIMKILTCYSARFYGARGGRKKKNKAENESGESNGI |
| Ga0180432_111632041 | 3300017989 | Hypersaline Lake Sediment | KYEEELAEDIMKILTCYSARFYGARGGRKKKNKAENEPNESNGI |
| Ga0180434_100066011 | 3300017991 | Hypersaline Lake Sediment | EDIMKILTCYSARFYSARGGRKKKNKAENEPDESNGI |
| Ga0180434_112891363 | 3300017991 | Hypersaline Lake Sediment | VEKKEKKYEEELAEDIMKILTCYSARFYGARGGRKKKNKAENETSESNGL |
| Ga0180433_103616671 | 3300018080 | Hypersaline Lake Sediment | DIMKILTCYSARYYGARGGRKKKNKAENEPNESNGI |
| Ga0180433_104148491 | 3300018080 | Hypersaline Lake Sediment | EDIMKILTCYSARFYGARGGRKKKSKLENETSESNGI |
| Ga0180433_108979823 | 3300018080 | Hypersaline Lake Sediment | LAEDIMKILTCYSARYYGARGGRKKKKLPENEVAEKV |
| Ga0222679_10393731 | 3300022858 | Saline Water | AEDIMKILTCYSARYYGRRGGRKKKNVEENQTIESNGI |
| Ga0222679_10686701 | 3300022858 | Saline Water | ELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI |
| Ga0222698_10319791 | 3300022860 | Saline Water | AEDIMKILTCYSARYYGRRGGRKKKNTEKNQNIESNGI |
| Ga0222685_10523212 | 3300022874 | Saline Water | TVEIVELKEQKYEEELAEDIMKILTCYSARFYGGRGGRKKKNTEENQPIESNGI |
| Ga0222642_10913601 | 3300022887 | Saline Water | AEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI |
| Ga0222667_10635061 | 3300022890 | Saline Water | FKNLEVTVEIVELKEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI |
| (restricted) Ga0233410_100287244 | 3300023276 | Seawater | MKILTCCSAGFYGRGGGRKKKNKAENEINESSGIQKGG |
| Ga0222680_10043177 | 3300023434 | Saline Water | EVTVEIVELKEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI |
| Ga0222680_10750311 | 3300023434 | Saline Water | LDAIFKNLEITVEIVEAKEQKYEEELAEDIMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI |
| Ga0222637_10621293 | 3300023435 | Saline Water | QKYEEELAEDIMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI |
| (restricted) Ga0233446_10742442 | 3300024256 | Seawater | MKIYKITGDIMKILTCCSARFYGRGGGRKKKNKAENEINESNGI |
| Ga0208045_11074133 | 3300025306 | Freshwater | EYLDAIFTNLEIEVAIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI |
| Ga0208905_10232557 | 3300025661 | Lake Water | ELAEDIMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI |
| Ga0209407_10075307 | 3300025689 | Anaerobic Digestor Sludge | EDIMKILTCYSARFYGRRGGRKKKNTVENESNESNGI |
| Ga0208771_11027411 | 3300025698 | Saline Lake | YEEELAEDIMKILTCYSARYYGRRGGRKKKNIEKNQTIESNGI |
| Ga0209507_11122041 | 3300025706 | Anaerobic Digestor Sludge | VIDTKERKYEEELAEDIMKILTCYSARYYGARGGRKKKIEVVESNAIK |
| Ga0209201_10323641 | 3300025708 | Anaerobic Digestor Sludge | VEIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENMPVESNGI |
| Ga0208458_11743713 | 3300025714 | Anaerobic Digestor Sludge | AEDIMKILTCYSARYYGARGGRKKKIKVENESVESNGI |
| Ga0207997_10678744 | 3300025736 | Saline Lake | DAIFKNLEVTVEIVELKEQKYEEELAEDIMKILTCYSARFYGGRGGRKKKNTEENQPIESNGI |
| Ga0207997_11155981 | 3300025736 | Saline Lake | DAIFKNLEVTVEIVELKEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTEENQPIESNGI |
| Ga0207997_11386511 | 3300025736 | Saline Lake | FRNLGIKVEIMQDKTQKYEEELAEDIMKILTCYSARYYGARGGRKKGYKVPKKASVDSN |
| Ga0209605_10582805 | 3300025861 | Anaerobic Digestor Sludge | AEDIMKILTCYSARYYGARGGRKKKNQVENIPAESNGI |
| Ga0208822_10028811 | 3300025866 | Anaerobic Digestor Sludge | IMDTKERKYEEELAEDIMKILTCYSAKYYGARGGRKKKIAVVESNAIQ |
| Ga0209702_101868131 | 3300027976 | Freshwater | LAEDIMKILTCYSARYYGRRGGIKKKNTEKNQNIESNGI |
| Ga0268277_10823311 | 3300028168 | Saline Water | LAEDIMKILTCYSARFYGRRGGRKKKNTTENEPTESNGI |
| Ga0265595_11393601 | 3300028191 | Saline Water | VEIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPAESNGI |
| (restricted) Ga0255343_11492132 | 3300028561 | Wastewater | MKIYKITCYSARYYGARGGRKKKNQVENIPGESNGI |
| (restricted) Ga0255344_11645023 | 3300028564 | Wastewater | ELAEDIMKILTCYSARFYGRRGGRKKKIKVENEPDESNGI |
| Ga0302152_101904681 | 3300028572 | Bog | AEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI |
| (restricted) Ga0255340_10301461 | 3300028576 | Wastewater | AEDIMKILTCYSARFYGRRGGRKKKNTAENEPIESNGI |
| (restricted) Ga0255340_11558723 | 3300028576 | Wastewater | MKIYKITCYSARYYGARGGRKKKNQVENIPGESNG |
| Ga0265294_102534713 | 3300028602 | Groundwater | MKKNYMKILTCYSARYYGARGGRKKKNKTENEPVESNGI |
| Ga0265293_101773363 | 3300028603 | Landfill Leachate | MEVKDKKYEEELAEDIMKILTCYSARYYGARGGRKKKIKVENELVESNGI |
| Ga0302248_10610012 | 3300028629 | Activated Sludge | MKIYKITYYSARYYGARGGRKKKNQVENIPGESNGI |
| Ga0272441_106946064 | 3300028920 | Marine Sediment | VVEKKDKKYEEELAEDIMKILTCYSAIFYGARGGRKKKNKAENEPDESNGI |
| Ga0168034_1029632 | 3300029171 | Aquarium Water | VEIKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKIEPVKEPNESNGI |
| Ga0302192_100140691 | 3300030507 | Bog | YEEELAEDIMKILTCYSARYYGARGGRKKKIKVENEPVESNGI |
| Ga0307378_104298994 | 3300031566 | Soil | NVEIVELKEQKYEEELAEDIMKILTCYSARFYGRRGGRKKKNKAENEPNESNGI |
| Ga0307375_101800374 | 3300031669 | Soil | LAEDIMKILTCYSARFYGRRGGRKKKNKAENEDNESNGI |
| Ga0307377_107581241 | 3300031673 | Soil | KEKKYEEELAEDIMKILTCYSARFYGRRGGRKKKNTAENEPNESNGI |
| Ga0315291_1001409423 | 3300031707 | Sediment | AEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI |
| Ga0315293_100727452 | 3300031746 | Sediment | MDTKERKYEEELAEDIMKILTCYSARYYGARGGRKKKIAVVESNAI |
| Ga0315290_102923014 | 3300031834 | Sediment | MKYEEELAEDIMKILTCYSARYYGARGGRKKKIIQEIPPVESNGI |
| Ga0315285_102746401 | 3300031885 | Sediment | EELAEDIMKILTCYSARYYGARGGRKKKNQAENMPVESNGI |
| Ga0315274_100908917 | 3300031999 | Sediment | IMETKEKKYEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI |
| Ga0315272_102271702 | 3300032018 | Sediment | MKIYKITEDIMKILTCYSARYYGARGGRKKKNQAENMPVESNGI |
| Ga0315281_104586361 | 3300032163 | Sediment | LKEKKYEEELAEDIMKILTCYSARYYGARGDRKKKTEPVKEPNESNGI |
| Ga0315283_112082831 | 3300032164 | Sediment | MKIYKIYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI |
| Ga0315268_102978184 | 3300032173 | Sediment | IFTNLEIEVEIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNG |
| Ga0315287_1007550111 | 3300032397 | Sediment | TNLEIEVAIMETKEKKYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNGI |
| Ga0315287_104306312 | 3300032397 | Sediment | LKSKNKKYEEELAEDIMKILTCYSARYYGARGGRKKKTEPVKEPNESNGI |
| Ga0315287_111910831 | 3300032397 | Sediment | MKIYKIYEEELAEDIMKILTCYSARYYGARGGRKKKNQAENTPVESNRI |
| Ga0315273_115611504 | 3300032516 | Sediment | TKERKYEEELAEDIMKILTCYSARYYGARGGRKKKIEIVESNAI |
| Ga0334895_10941321 | 3300033171 | Sludge | EDIMKILTCYSARFYGRRGGRKKKNTAENEPIESNGI |
| ⦗Top⦘ |