| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007029 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117923 | Gp0125730 | Ga0102677 |
| Sample Name | Non-marine hypersaline water viral communities from A?ana, Logro?o,Spain - Vir_A?ana_3_PRE |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Alicante |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 31953569 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | A?ana, ?lva, Pais Vasco, Spain | |||||||
| Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021062 | Metagenome / Metatranscriptome | 220 | Y |
| F051532 | Metagenome / Metatranscriptome | 144 | Y |
| F095532 | Metagenome / Metatranscriptome | 105 | N |
| F096721 | Metagenome | 104 | N |
| F104017 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102677_101432 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| Ga0102677_101771 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| Ga0102677_104576 | Not Available | 1094 | Open in IMG/M |
| Ga0102677_111816 | Not Available | 650 | Open in IMG/M |
| Ga0102677_115957 | Not Available | 545 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102677_101432 | Ga0102677_1014321 | F051532 | AEDIMKILTCYSARFYGRRGGRKKKNTAENEPNESNGI* |
| Ga0102677_101771 | Ga0102677_1017713 | F096721 | MVGSIFAYIEDGIPEQALFDLTIIAQNAKDFEAGMSALVELGDIINDHYSEREPDYGPYDEIEDSIWGNEGDDFDPPEDWFTDGGPFGPDEDL* |
| Ga0102677_104576 | Ga0102677_1045761 | F021062 | YETEDEKVYFFEPLEKEISVEDMQKIVDINEKLVKDMKDGKSSNRL* |
| Ga0102677_111816 | Ga0102677_1118162 | F095532 | MKRQNVIVVIAPTLEVWGNFKKLCEAKGFEILPYHSLKSKPFPIIHNGWIIHKVPFF* |
| Ga0102677_115957 | Ga0102677_1159572 | F104017 | MKQPTLTEIRKHVERKGGSYKKLKMTLNGNAAYEVDGVTMTRAQMIERYMLGEL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |