


| Basic Information | |
|---|---|
| Family ID | F033176 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MDPKLTILFLLIGAIIVLSHLTEENLGRMRRQLVDRRWREFVPLRRRS |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.31 % |
| % of genes near scaffold ends (potentially truncated) | 19.66 % |
| % of genes from short scaffolds (< 2000 bps) | 78.09 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.045 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (16.854 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.011 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.74% β-sheet: 0.00% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF01343 | Peptidase_S49 | 17.98 |
| PF05175 | MTS | 8.99 |
| PF09413 | DUF2007 | 5.62 |
| PF03401 | TctC | 2.81 |
| PF13659 | Obsolete Pfam Family | 2.81 |
| PF02091 | tRNA-synt_2e | 2.25 |
| PF01972 | SDH_sah | 1.69 |
| PF06938 | DUF1285 | 1.12 |
| PF02805 | Ada_Zn_binding | 0.56 |
| PF13561 | adh_short_C2 | 0.56 |
| PF03797 | Autotransporter | 0.56 |
| PF08544 | GHMP_kinases_C | 0.56 |
| PF00535 | Glycos_transf_2 | 0.56 |
| PF00596 | Aldolase_II | 0.56 |
| PF07486 | Hydrolase_2 | 0.56 |
| PF00180 | Iso_dh | 0.56 |
| PF09972 | DUF2207 | 0.56 |
| PF00654 | Voltage_CLC | 0.56 |
| PF13631 | Cytochrom_B_N_2 | 0.56 |
| PF00348 | polyprenyl_synt | 0.56 |
| PF13450 | NAD_binding_8 | 0.56 |
| PF13649 | Methyltransf_25 | 0.56 |
| PF00753 | Lactamase_B | 0.56 |
| PF09360 | zf-CDGSH | 0.56 |
| PF02913 | FAD-oxidase_C | 0.56 |
| PF02894 | GFO_IDH_MocA_C | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 39.33 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.81 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 2.25 |
| COG3816 | Uncharacterized conserved protein, DUF1285 family | Function unknown [S] | 1.12 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.56 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.56 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.56 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.04 % |
| Unclassified | root | N/A | 35.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000695|JGI12539J11930_103176 | Not Available | 538 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103583523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 565 | Open in IMG/M |
| 3300001867|JGI12627J18819_10094845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1234 | Open in IMG/M |
| 3300002906|JGI25614J43888_10147533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 625 | Open in IMG/M |
| 3300004006|Ga0055453_10220606 | Not Available | 599 | Open in IMG/M |
| 3300004479|Ga0062595_100395227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300005327|Ga0070658_11649508 | Not Available | 555 | Open in IMG/M |
| 3300005434|Ga0070709_10032744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3137 | Open in IMG/M |
| 3300005435|Ga0070714_100474827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1190 | Open in IMG/M |
| 3300005436|Ga0070713_100427439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1241 | Open in IMG/M |
| 3300005439|Ga0070711_100016389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4706 | Open in IMG/M |
| 3300005529|Ga0070741_10002441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 49989 | Open in IMG/M |
| 3300005534|Ga0070735_10439899 | Not Available | 779 | Open in IMG/M |
| 3300005538|Ga0070731_10000309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 75495 | Open in IMG/M |
| 3300005607|Ga0070740_10022950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3751 | Open in IMG/M |
| 3300005833|Ga0074472_11270587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 560 | Open in IMG/M |
| 3300005881|Ga0075294_1028775 | Not Available | 561 | Open in IMG/M |
| 3300006050|Ga0075028_100178298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
| 3300006050|Ga0075028_100631508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
| 3300006055|Ga0097691_1104614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300006059|Ga0075017_100162753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1596 | Open in IMG/M |
| 3300006173|Ga0070716_101129061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300006354|Ga0075021_10303173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 990 | Open in IMG/M |
| 3300006638|Ga0075522_10000039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 69128 | Open in IMG/M |
| 3300006795|Ga0075520_1228599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 780 | Open in IMG/M |
| 3300006950|Ga0075524_10035815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2017 | Open in IMG/M |
| 3300007516|Ga0105050_10689141 | Not Available | 589 | Open in IMG/M |
| 3300009091|Ga0102851_10879193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 965 | Open in IMG/M |
| 3300009093|Ga0105240_10492239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1365 | Open in IMG/M |
| 3300009650|Ga0105857_1061754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 985 | Open in IMG/M |
| 3300009662|Ga0105856_1031448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1501 | Open in IMG/M |
| 3300009839|Ga0116223_10332122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 902 | Open in IMG/M |
| 3300010366|Ga0126379_12411846 | Not Available | 625 | Open in IMG/M |
| 3300010371|Ga0134125_10860034 | Not Available | 997 | Open in IMG/M |
| 3300010371|Ga0134125_12755592 | Not Available | 534 | Open in IMG/M |
| 3300010396|Ga0134126_11865475 | Not Available | 658 | Open in IMG/M |
| 3300011423|Ga0137436_1053253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1036 | Open in IMG/M |
| 3300011442|Ga0137437_1165235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 767 | Open in IMG/M |
| 3300011996|Ga0120156_1077902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 601 | Open in IMG/M |
| 3300011999|Ga0120148_1063615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300012931|Ga0153915_10143415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2582 | Open in IMG/M |
| 3300012931|Ga0153915_10452933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1460 | Open in IMG/M |
| 3300012931|Ga0153915_11223241 | Not Available | 877 | Open in IMG/M |
| 3300012931|Ga0153915_11888905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300012931|Ga0153915_13107804 | Not Available | 540 | Open in IMG/M |
| 3300012940|Ga0164243_10131648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2238 | Open in IMG/M |
| 3300012940|Ga0164243_10274308 | Not Available | 1245 | Open in IMG/M |
| 3300012940|Ga0164243_10329094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1076 | Open in IMG/M |
| 3300012984|Ga0164309_10887578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 725 | Open in IMG/M |
| 3300013770|Ga0120123_1126460 | Not Available | 597 | Open in IMG/M |
| 3300014054|Ga0120135_1056889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300014056|Ga0120125_1117202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300014159|Ga0181530_10468504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300014502|Ga0182021_12466854 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300014502|Ga0182021_12943270 | Not Available | 571 | Open in IMG/M |
| 3300014838|Ga0182030_10027390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 10252 | Open in IMG/M |
| 3300014838|Ga0182030_10828070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 842 | Open in IMG/M |
| 3300015080|Ga0167639_1037087 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300015089|Ga0167643_1004982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1815 | Open in IMG/M |
| 3300015167|Ga0167661_1080561 | Not Available | 590 | Open in IMG/M |
| 3300015190|Ga0167651_1003830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3540 | Open in IMG/M |
| 3300015245|Ga0137409_11184209 | Not Available | 605 | Open in IMG/M |
| 3300017645|Ga0182749_1108760 | Not Available | 733 | Open in IMG/M |
| 3300017647|Ga0182748_1183910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 516 | Open in IMG/M |
| 3300017650|Ga0182736_1180416 | Not Available | 625 | Open in IMG/M |
| 3300017927|Ga0187824_10077103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
| 3300017930|Ga0187825_10122671 | Not Available | 908 | Open in IMG/M |
| 3300017934|Ga0187803_10037663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1920 | Open in IMG/M |
| 3300017936|Ga0187821_10307567 | Not Available | 631 | Open in IMG/M |
| 3300017939|Ga0187775_10101524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 967 | Open in IMG/M |
| 3300017944|Ga0187786_10160074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 821 | Open in IMG/M |
| 3300017944|Ga0187786_10365014 | Not Available | 615 | Open in IMG/M |
| 3300017947|Ga0187785_10207710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 856 | Open in IMG/M |
| 3300017947|Ga0187785_10346847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 697 | Open in IMG/M |
| 3300017947|Ga0187785_10520366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Amorphaceae → Acuticoccus → Acuticoccus sediminis | 596 | Open in IMG/M |
| 3300017947|Ga0187785_10588278 | Not Available | 569 | Open in IMG/M |
| 3300017959|Ga0187779_10000047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 88345 | Open in IMG/M |
| 3300017961|Ga0187778_11303342 | Not Available | 511 | Open in IMG/M |
| 3300017966|Ga0187776_10421394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 897 | Open in IMG/M |
| 3300017966|Ga0187776_10947887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 629 | Open in IMG/M |
| 3300017973|Ga0187780_11463435 | Not Available | 504 | Open in IMG/M |
| 3300018029|Ga0187787_10044095 | Not Available | 1294 | Open in IMG/M |
| 3300018029|Ga0187787_10291668 | Not Available | 610 | Open in IMG/M |
| 3300018060|Ga0187765_10256412 | Not Available | 1033 | Open in IMG/M |
| 3300018060|Ga0187765_10281030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 991 | Open in IMG/M |
| 3300018083|Ga0184628_10005551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6026 | Open in IMG/M |
| 3300018083|Ga0184628_10117472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1374 | Open in IMG/M |
| 3300018088|Ga0187771_10021490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4814 | Open in IMG/M |
| 3300020010|Ga0193749_1088622 | Not Available | 560 | Open in IMG/M |
| 3300020060|Ga0193717_1031866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2047 | Open in IMG/M |
| 3300020592|Ga0180222_1014192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2497 | Open in IMG/M |
| 3300021363|Ga0193699_10002679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6729 | Open in IMG/M |
| 3300021420|Ga0210394_11205679 | Not Available | 650 | Open in IMG/M |
| 3300022553|Ga0212124_10657586 | Not Available | 541 | Open in IMG/M |
| 3300025313|Ga0209431_10782062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 696 | Open in IMG/M |
| 3300025495|Ga0207932_1004755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4437 | Open in IMG/M |
| 3300025679|Ga0207933_1000018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 166317 | Open in IMG/M |
| 3300025846|Ga0209538_1210753 | Not Available | 720 | Open in IMG/M |
| 3300025852|Ga0209124_10349764 | Not Available | 546 | Open in IMG/M |
| 3300025888|Ga0209540_10162236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1345 | Open in IMG/M |
| 3300025891|Ga0209585_10077871 | Not Available | 1240 | Open in IMG/M |
| 3300025891|Ga0209585_10165508 | Not Available | 858 | Open in IMG/M |
| 3300025891|Ga0209585_10416872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300025928|Ga0207700_10977983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 757 | Open in IMG/M |
| 3300025939|Ga0207665_10491194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 947 | Open in IMG/M |
| 3300026222|Ga0209862_1070011 | Not Available | 603 | Open in IMG/M |
| 3300026319|Ga0209647_1026447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3478 | Open in IMG/M |
| 3300026692|Ga0207725_100365 | Not Available | 1926 | Open in IMG/M |
| 3300026809|Ga0207820_111961 | Not Available | 653 | Open in IMG/M |
| 3300026899|Ga0209326_1003906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300027706|Ga0209581_1003389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13785 | Open in IMG/M |
| 3300027815|Ga0209726_10098103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1782 | Open in IMG/M |
| 3300027819|Ga0209514_10276766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 783 | Open in IMG/M |
| 3300027869|Ga0209579_10000112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 141742 | Open in IMG/M |
| 3300027894|Ga0209068_10736802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 579 | Open in IMG/M |
| 3300027902|Ga0209048_10050748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3385 | Open in IMG/M |
| 3300027902|Ga0209048_10051115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3371 | Open in IMG/M |
| 3300027902|Ga0209048_10407479 | Not Available | 932 | Open in IMG/M |
| 3300027905|Ga0209415_10363582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1195 | Open in IMG/M |
| 3300027910|Ga0209583_10457578 | Not Available | 621 | Open in IMG/M |
| 3300027915|Ga0209069_10238032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 942 | Open in IMG/M |
| 3300027986|Ga0209168_10321905 | Not Available | 758 | Open in IMG/M |
| 3300028800|Ga0265338_10383803 | Not Available | 1004 | Open in IMG/M |
| 3300029945|Ga0311330_10126412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2488 | Open in IMG/M |
| 3300030916|Ga0075386_12015294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1670 | Open in IMG/M |
| 3300031235|Ga0265330_10334710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 639 | Open in IMG/M |
| 3300031241|Ga0265325_10000264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 37210 | Open in IMG/M |
| 3300031366|Ga0307506_10446454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 539 | Open in IMG/M |
| 3300031712|Ga0265342_10313830 | Not Available | 823 | Open in IMG/M |
| 3300031723|Ga0318493_10603113 | Not Available | 612 | Open in IMG/M |
| 3300031779|Ga0318566_10179218 | Not Available | 1051 | Open in IMG/M |
| 3300031788|Ga0302319_10754409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 974 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1008469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7570 | Open in IMG/M |
| 3300031894|Ga0318522_10320467 | Not Available | 587 | Open in IMG/M |
| 3300031949|Ga0214473_10277914 | Not Available | 1918 | Open in IMG/M |
| 3300031996|Ga0308176_10209813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1839 | Open in IMG/M |
| 3300032025|Ga0318507_10172304 | Not Available | 930 | Open in IMG/M |
| 3300032041|Ga0318549_10026361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2255 | Open in IMG/M |
| 3300032052|Ga0318506_10558660 | Not Available | 507 | Open in IMG/M |
| 3300032055|Ga0318575_10024068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2591 | Open in IMG/M |
| 3300032066|Ga0318514_10692517 | Not Available | 542 | Open in IMG/M |
| 3300032770|Ga0335085_10007145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 17435 | Open in IMG/M |
| 3300032770|Ga0335085_10123853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3294 | Open in IMG/M |
| 3300032770|Ga0335085_10167714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2730 | Open in IMG/M |
| 3300032770|Ga0335085_10813980 | Not Available | 1027 | Open in IMG/M |
| 3300032770|Ga0335085_10904317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 962 | Open in IMG/M |
| 3300032770|Ga0335085_11405887 | Not Available | 731 | Open in IMG/M |
| 3300032770|Ga0335085_11727927 | Not Available | 644 | Open in IMG/M |
| 3300032782|Ga0335082_10052666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4202 | Open in IMG/M |
| 3300032782|Ga0335082_10808092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 800 | Open in IMG/M |
| 3300032782|Ga0335082_11195016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 628 | Open in IMG/M |
| 3300032783|Ga0335079_10368219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1555 | Open in IMG/M |
| 3300032783|Ga0335079_10408105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1463 | Open in IMG/M |
| 3300032783|Ga0335079_12216561 | Not Available | 524 | Open in IMG/M |
| 3300032783|Ga0335079_12254038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 518 | Open in IMG/M |
| 3300032805|Ga0335078_12093400 | Not Available | 601 | Open in IMG/M |
| 3300032805|Ga0335078_12745036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 500 | Open in IMG/M |
| 3300032828|Ga0335080_10122064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2891 | Open in IMG/M |
| 3300032828|Ga0335080_10899374 | Not Available | 908 | Open in IMG/M |
| 3300032828|Ga0335080_11564203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 650 | Open in IMG/M |
| 3300032892|Ga0335081_10015496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 12326 | Open in IMG/M |
| 3300032892|Ga0335081_10070479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5349 | Open in IMG/M |
| 3300032892|Ga0335081_10305867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2102 | Open in IMG/M |
| 3300032892|Ga0335081_10435583 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300032892|Ga0335081_10660536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1277 | Open in IMG/M |
| 3300032892|Ga0335081_12045291 | Not Available | 609 | Open in IMG/M |
| 3300032893|Ga0335069_12107339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
| 3300033475|Ga0310811_10764222 | Not Available | 913 | Open in IMG/M |
| 3300033480|Ga0316620_11185414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300033513|Ga0316628_100049185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4357 | Open in IMG/M |
| 3300033513|Ga0316628_102801862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 641 | Open in IMG/M |
| 3300033513|Ga0316628_103624731 | Not Available | 556 | Open in IMG/M |
| 3300033809|Ga0314871_015384 | Not Available | 598 | Open in IMG/M |
| 3300034130|Ga0370494_092104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
| 3300034130|Ga0370494_171860 | Not Available | 559 | Open in IMG/M |
| 3300034195|Ga0370501_0347227 | Not Available | 539 | Open in IMG/M |
| 3300034818|Ga0373950_0037055 | Not Available | 922 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 16.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 6.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.93% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 3.37% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.25% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.25% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.69% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.12% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.12% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.12% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.12% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.56% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.56% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.56% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.56% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000695 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017645 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017647 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft OP (version 2) | Environmental | Open in IMG/M |
| 3300017650 | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft BY (version 2) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020592 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft OP (version 2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033809 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12539J11930_1031762 | 3300000695 | Tropical Forest Soil | MDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS* |
| JGIcombinedJ13530_1035835232 | 3300001213 | Wetland | MDPKIGLLFLLIGAVIVLSHLSEENLGRVRRQLAGRRWREIMPGRRRV* |
| JGI12627J18819_100948453 | 3300001867 | Forest Soil | MDPKITILFVLIGVIIALSHLNEERLXRFWRQFAGRGWRDFMPVRRRT* |
| JGI25614J43888_101475332 | 3300002906 | Grasslands Soil | MDPKIALLFLLIGAVIVLSHLSDENLGRMRRQIAERRWREFVPRRRRA* |
| Ga0055453_102206062 | 3300004006 | Natural And Restored Wetlands | MDPKLTLLFLLIGTVVGLSHLSDDSLSRMRRQLIDRRWREFVRGRRKF* |
| Ga0062595_1003952271 | 3300004479 | Soil | MDPKLAILFFLITGILALSYLTEENMQRIRSQLAVRRWREFVPGQRKS* |
| Ga0070658_116495081 | 3300005327 | Corn Rhizosphere | MDPKLAILLLLIGGVIGLSHLSEENLGRMRSQFVARNWGRLVRRRA* |
| Ga0070709_100327443 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIVPGRRRG* |
| Ga0070714_1004748273 | 3300005435 | Agricultural Soil | NAHGTTAEWGIGRGGLMDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIVPGRRRG* |
| Ga0070713_1004274392 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPKLTLLFLFIGAVVVLSHLTDETLTRVRRRLIDSRWRQFVRISRKI* |
| Ga0070711_1000163896 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIMPGRRRV* |
| Ga0070741_1000244143 | 3300005529 | Surface Soil | MDPKLTLLFMLIGAVVVLSHLTDENLTRMRRQLVDRRWRQFVRLPRKF* |
| Ga0070735_104398991 | 3300005534 | Surface Soil | MDPKLTILILLIGTVIGLSHLSDDRLSRVRRQLAGRRWREIVPGWRKS* |
| Ga0070731_1000030926 | 3300005538 | Surface Soil | MDPKLTILFLLIGVVIALSNLTDDRLARLRRQLASRRWREFVPGRRKA* |
| Ga0070740_100229506 | 3300005607 | Surface Soil | MDPKLTLLFLLIGAVIVLSNLGDDSLTRMRRQLADRPWRNLMRVRRKY* |
| Ga0074472_112705872 | 3300005833 | Sediment (Intertidal) | MDPKLTILIMLIGAVIVLSHLTEENLGRMRRQLVDRRWRKIVPLRRRS* |
| Ga0075294_10287752 | 3300005881 | Rice Paddy Soil | MDPKITILFMLIGAIIGLSHLNAENLGRLQRQLVRRRWREFMPRWRKS* |
| Ga0075028_1001782982 | 3300006050 | Watersheds | MDPKLTMLFVLIGAVVVLSHLTDDNLTRVRRQLVDRRWRNFVRISRKI* |
| Ga0075028_1006315081 | 3300006050 | Watersheds | MDPKLGLLFLLIGTVIVLSHLSEENLGRVRRQLADLRWREIVPGRRRA* |
| Ga0097691_11046142 | 3300006055 | Arctic Peat Soil | MDPKLMILFLLIGCVIGFSHLNEENLGRMRRQIVDRRWREFVPLRRRS* |
| Ga0075017_1001627532 | 3300006059 | Watersheds | MDPKLTMLFVLIGAVVVLSHLTDDNLTRVRRQLLDRRWRNFVRISRKI* |
| Ga0070716_1011290611 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EWGIGRGGLMDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIVPGRRRG* |
| Ga0075021_103031732 | 3300006354 | Watersheds | MDPKLTILFMLIGAVIALSHMTEENLGRVRRQIVDRRWREFVPLRRRF* |
| Ga0075522_100000395 | 3300006638 | Arctic Peat Soil | MDPKLTILFMLIGSIITLSHLADGTLGRVRRQISNRGWREIMPGRRRI* |
| Ga0075520_12285992 | 3300006795 | Arctic Peat Soil | MDPKLTILFVLIGCVVGLSHLNEENLGRMRRQLVSRNWREFVPLRRRS* |
| Ga0075524_100358155 | 3300006950 | Arctic Peat Soil | MDPKLTILFLLIGCVVGLSHLNEENLGRMRRQLVTRNWREFVPLRRR |
| Ga0105050_106891411 | 3300007516 | Freshwater | MDPKLTILFMLIGSIITMSHLADGTFGRVRRQISMRRWRRQA* |
| Ga0102851_108791932 | 3300009091 | Freshwater Wetlands | MDPKLTILIILIGAVIALSNLNEKTLGRMRRQFVVRRWRKIMPLRRRS* |
| Ga0105240_104922392 | 3300009093 | Corn Rhizosphere | MDPKLTLLFLFIGAVVVLSHLTDETLTRVRRRLIDSRWRQFVRISRRI* |
| Ga0105857_10617542 | 3300009650 | Permafrost Soil | MDPKLTILFLLIGCVVLLSHLNEENLGRMRRQIASRSWRDLVPVRRRS* |
| Ga0105856_10314482 | 3300009662 | Permafrost Soil | MDPKLTILVMLIGAIIALSHLNEENLGRMRRQLVGRRWREMMPLRRRS* |
| Ga0116223_103321222 | 3300009839 | Peatlands Soil | MDPKLTILFLLIGSVITLSHLNDDNLARMRRQFINRRWREFVPGWRKS* |
| Ga0126379_124118461 | 3300010366 | Tropical Forest Soil | MDPKIGLLFLLIGVVIVLSHLSEENLGRVRRQFTDRRWREIMPGRRRV* |
| Ga0134125_108600342 | 3300010371 | Terrestrial Soil | MTRRRLEEAKSMDPKIALLFLLIASVIGLSHLSEENISRVRQQLADLRWREIIPRRRRV* |
| Ga0134125_127555921 | 3300010371 | Terrestrial Soil | MDPKLTLLVMFIGAVVVLSHLTDETLTRVRRRLIDSRWRQFVRISRKI* |
| Ga0134126_118654752 | 3300010396 | Terrestrial Soil | MDPKLTMLFVLIGAVVALSHLTDDNLMRVRRQLVDRRWRNFM |
| Ga0137436_10532532 | 3300011423 | Soil | MDPKLTILFVLIACVVGLSHLNEENLGRMRRQLVRRNWRDFVPLRRRS* |
| Ga0137437_11652352 | 3300011442 | Soil | MDPKLTILFMLIGAVVALSHLSEENLARMRRQIVDRRWREFVPLRRRS* |
| Ga0120156_10372481 | 3300011996 | Permafrost | MDPKLTMLFVLIGAVVALSHLTDDNLTRMRRQLVDR |
| Ga0120156_10779023 | 3300011996 | Permafrost | LLISGVIGLSHLNDENLVRLRRQLVIRRWREFVPGRRKS* |
| Ga0120148_10636152 | 3300011999 | Permafrost | MDPKLTMLFVLIGAVVALSHLTDDNLTRMRRQLADRRWRNFVRISRKI* |
| Ga0153915_101434154 | 3300012931 | Freshwater Wetlands | MDPKIGLLFLLIGTVIVLSHLSDENLGRVRRQLAGRRWREIMPRRRRA* |
| Ga0153915_104529331 | 3300012931 | Freshwater Wetlands | MDPKLTMLFLLIGAVVVLSHLNEENLTRMRRQLVDRRWRNFVRISRKI* |
| Ga0153915_112232412 | 3300012931 | Freshwater Wetlands | MDPKLAILFMLIGAIIALSHLNDENLSRMRRQLIELRWRKIVPLWRRF* |
| Ga0153915_118889051 | 3300012931 | Freshwater Wetlands | MDPKLTLLFMLIGAVVGLSHLSEENLGRMRRQLVDRRWREFVRIRRKI* |
| Ga0153915_131078042 | 3300012931 | Freshwater Wetlands | MDPKLTILFMLIGAVIALSHLTEENLGRMRRQFVDRRWRKIVPSRRRS* |
| Ga0164243_101316481 | 3300012940 | Compost | MEPKITLLFMLIATVIGLSYLTEENLGRLRRQLGLRRWRGFAPLRRRI* |
| Ga0164243_102743081 | 3300012940 | Compost | MDPKITLLFVLIATVIGLSYLTEENLGRLRRYLVQRGWRG |
| Ga0164243_103290941 | 3300012940 | Compost | MDPKITLLLVLIATVIGLSYLTEENIGRLRRQLDLGRWREFVPLRRRV* |
| Ga0164309_108875781 | 3300012984 | Soil | IGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIMPGRRRV* |
| Ga0120123_11264601 | 3300013770 | Permafrost | MDPKLTMLFVLIGAVVALSHLTDDNLTRMRRQLVDRRWRNFVRISRKI* |
| Ga0120135_10568892 | 3300014054 | Permafrost | MDPKLTTLFLLIGVVIALSNLTEDRLARLRRQMASRRWREFVPGRRKD* |
| Ga0120125_11172022 | 3300014056 | Permafrost | TILFVLIGSIIGLSHLNDDNLARMRRQIVTRRWREFVPGRRKS* |
| Ga0181530_104685041 | 3300014159 | Bog | LAILFLLISSIIALSHLDDDNLARMRRQFVNRRWREMVPGRRKS* |
| Ga0182021_124668542 | 3300014502 | Fen | MMDPKLGILFILIGAIIALSNLTEENLGRMRRQFVDRRWREFVPLRRRS* |
| Ga0182021_129432702 | 3300014502 | Fen | MDPKLTILFLLIGCVIGLSHLNEENLGRMRRQLVGRDWGRLVRRRA* |
| Ga0182030_100273905 | 3300014838 | Bog | MDPKLTILFLLIGCVVGLSHLNEENMGRMRRQIANRNWRQFVPLRRRS* |
| Ga0182030_108280702 | 3300014838 | Bog | MDPKLTILFLLIGCVVGLSHLNEENMGRMRRQIASRNWREFVPLRRRS* |
| Ga0167639_10370871 | 3300015080 | Glacier Forefield Soil | ILFVLISAVIGLSHLNDDNLARMRRQLVIRRWREFVPGWRKS* |
| Ga0167643_10049823 | 3300015089 | Glacier Forefield Soil | MDPKLTILVMLIGAIIALSHLNDENLGRMRRQIVDRRWREMMPLRRRS* |
| Ga0167661_10805612 | 3300015167 | Glacier Forefield Soil | MDPKLMILFLLIGCVIGLSHLNEENLGRFRAQFAGRSWRDLVPVRRRS* |
| Ga0167651_10038302 | 3300015190 | Glacier Forefield Soil | MDPKLTMFFLLIGAIIGLSYLSEDAVARMRRQLAVKRWREFAPVRRKS* |
| Ga0137409_111842091 | 3300015245 | Vadose Zone Soil | MDPKLTILILLIGVVIVLSHLTEENLGRMRRQIVSRRWREMMPLRRRS* |
| Ga0182749_11087602 | 3300017645 | Compost | MDPKLTILFMLIGVVIGLSYLGDGSLRRMRRQIADGGWRQFVPLRRRS |
| Ga0182748_11839102 | 3300017647 | Compost | MDPKITLLLVLIATVIGLSYLTEENIGRLRRQLDLGRWREFVPLRRRV |
| Ga0182736_11804162 | 3300017650 | Soil | MDPKLTILFMLIGAVIVLSHISDGHFARVRRQFVQRRWRAIMPARRRS |
| Ga0187824_100771032 | 3300017927 | Freshwater Sediment | MDPKITLLFLLIAGVIGLSHLSEENLGRARRHLRERRWREIIPHRPRD |
| Ga0187825_101226712 | 3300017930 | Freshwater Sediment | MDPKLTILFVLISSIVALSHLDDDTLARMRRQFVNRRWREFVPGRRKF |
| Ga0187803_100376632 | 3300017934 | Freshwater Sediment | MDPKLTILFMLIGAVVVLSHLTDDNLTRVRRQLVDRRWRNFVRISRKI |
| Ga0187821_103075672 | 3300017936 | Freshwater Sediment | MDPKLTILFVLISSIVALSHLDDDTLARMRRQFVNRRWREFVPGRRKS |
| Ga0187775_101015241 | 3300017939 | Tropical Peatland | MDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIVPGRRRA |
| Ga0187786_101600742 | 3300017944 | Tropical Peatland | MDPKLTILFMLITAVVVLSHLTDENITRMRRQLVERRWRNFVRLSRKI |
| Ga0187786_103650142 | 3300017944 | Tropical Peatland | MDPKLTILFMLIGAVVVLSHLTDDNLTRVRRQLVDRRWRNFV |
| Ga0187785_102077102 | 3300017947 | Tropical Peatland | MLITAVVVLSHLTDENITRMRRQLVERRWRNFVRLSRKI |
| Ga0187785_103468471 | 3300017947 | Tropical Peatland | MDPKIGLLFLLIGTVIVLSHLSEETLGRLRRQVADRRWREIVPGRRRA |
| Ga0187785_105203662 | 3300017947 | Tropical Peatland | MDPKLTILFMLITAVVVLSHLTDENITRMRRQLVERRWRNFV |
| Ga0187785_105882782 | 3300017947 | Tropical Peatland | MDPKLTLLVMLIAAIVVLSHMSEDNLARMRRQFVGGRWRNFVRIPRKI |
| Ga0187779_1000004752 | 3300017959 | Tropical Peatland | MDPKLTILFMLITVVVVLSHLTDENLTRMRQQFVARRWRKFVRIPRKI |
| Ga0187778_113033422 | 3300017961 | Tropical Peatland | RGEIMDPKIALLFVLIGTVIVLSHLSDENLGRVRRQFAAGRWREIVPRRRRA |
| Ga0187776_104213942 | 3300017966 | Tropical Peatland | MDPKLTILFMLIGGIVALSHLNEENMQRVRRQLLARRWRHFVPGQRKS |
| Ga0187776_109478871 | 3300017966 | Tropical Peatland | MDPKIGLLFLLIGTVIVLSHLSEENLGRLRRQLADRRWRAIVPGRRRA |
| Ga0187780_114634351 | 3300017973 | Tropical Peatland | MDPKLAMLFLLIGVVIALSNLTEENLGRMRRQISARKWRGFVPGWRK |
| Ga0187787_100440952 | 3300018029 | Tropical Peatland | MEEAMDPKLTILFMLITAVVVLSHLTDENLTRMRQQLVDRRWRKFVRITRKI |
| Ga0187787_102916682 | 3300018029 | Tropical Peatland | MDPKLTLLFMLIGVVVALSHLTEENLARVRRQFIDRRWRQFVRPTRKF |
| Ga0187765_102564122 | 3300018060 | Tropical Peatland | MDPKLAILFLLVGAIIALSHLTEENIRRMRRPLIRLQWREFVPSRRKA |
| Ga0187765_102810301 | 3300018060 | Tropical Peatland | MDPKLTILFMLITAVVVLSHLTDENLTRMRQQFVARRWRKFVRIPRKI |
| Ga0184628_100055513 | 3300018083 | Groundwater Sediment | MDPKLTILFMLIGAVVALSHMTEENLGRVRRQLVYRRWREFVPRRRSS |
| Ga0184628_101174722 | 3300018083 | Groundwater Sediment | MDPKLTILFMLIGAVVALSHLSEENLARMRRQIVDRRWREFMPLRRRS |
| Ga0187771_100214907 | 3300018088 | Tropical Peatland | MDPKLAILFVLISSIIALSHLSEDNLARMRSQFVNGRWREIVPGRRKS |
| Ga0193749_10886221 | 3300020010 | Soil | MDPKIALLFLLIGAVIVLSHLSDENLGRMRRQLAERRWREFVPRRRRA |
| Ga0193717_10318662 | 3300020060 | Soil | MDPKLAILFLLVGSVIGLSHLNEEKLGQWRRQFVVKNWREFVPSRRRA |
| Ga0180222_10141923 | 3300020592 | Compost | MEPKITLLFMLIATVIGLSYLTEENLGRLRRQLGLRRWRGFAPLRRRI |
| Ga0193699_100026794 | 3300021363 | Soil | MDPKLTILFLLVGSVIGLSHLNEEKLGRWRRQLVVKNWREFVPSRRRG |
| Ga0210394_112056792 | 3300021420 | Soil | MDPKLTMLFVLIGVVVVLSHLTDDNLMRMRRQLVDRRWRNFVRISRKI |
| Ga0212124_106575861 | 3300022553 | Freshwater | MDPKLTILFLLIGCVIGLSSLNEENLGRMRRQLVSRRWREIVPLWRRS |
| Ga0209431_107820621 | 3300025313 | Soil | MDLKLTILFVLIGAVITLSHLTEENLGRMRRQFIDRRWRKIVPLRR |
| Ga0207932_10047552 | 3300025495 | Arctic Peat Soil | MDPKLTILFMLIGAVIVLSHLTEENLGRMRRQFVDRSWREFVPSRRKA |
| Ga0207933_100001835 | 3300025679 | Arctic Peat Soil | MDPKLTILFMLIGSIITLSHLADGTLGRVRRQISNRGWREIMPGRRRI |
| Ga0209538_12107533 | 3300025846 | Arctic Peat Soil | MDPKLGILFILIGAIIALSHLTEENLGRMRRQFMDRRWREFVPLRRRS |
| Ga0209124_103497642 | 3300025852 | Arctic Peat Soil | MDPKLAILFILIGAVIVLSHLTDENIGRMRQQFVDRRWREFVPLRRRS |
| Ga0209540_101622362 | 3300025888 | Arctic Peat Soil | MDPKLMILFLLIGCVIGFSHLNEENLGRMRRQIVDRRWREFVPLRRRS |
| Ga0209585_100778712 | 3300025891 | Arctic Peat Soil | MDPKLTILFLLIGCVVGLSHLNEENLGRMRRQLVTRNWREFVPLRRRS |
| Ga0209585_101655082 | 3300025891 | Arctic Peat Soil | MDPKLTILFLLIGAIIVLSHLTEENLGRMRRQLVDRRWREFVPLRRRS |
| Ga0209585_104168722 | 3300025891 | Arctic Peat Soil | MDPKLTILFVLIGCVVGLSHLNEENLGRMRRQLVSRNWREFVPLRRRS |
| Ga0207700_109779832 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAMDPKLTLLFLFIGAVVVLSHLTDETLTRVRRRLIDSRWRQFVRISRKI |
| Ga0207665_104911942 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FCNAHGTTAEWGIGRGGLMDPKIGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIMPGRRRV |
| Ga0209862_10700112 | 3300026222 | Permafrost Soil | MDPKLTILFLLIGCVVLLSHLNEENLGRMRRQIASRSWRDLVPVRRRS |
| Ga0209647_10264474 | 3300026319 | Grasslands Soil | MDPKIALLFLLIGAVIVLSHLSDENLGRMRRQIAERRWREFVPRRRRA |
| Ga0207725_1003653 | 3300026692 | Tropical Forest Soil | MDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS |
| Ga0207820_1119612 | 3300026809 | Tropical Forest Soil | MDPKLTILFMLIGAIIALSHLNDENLGRMRRRLIELRWRKIVPLWRRF |
| Ga0209326_10039062 | 3300026899 | Forest Soil | MDPKITILFVLIGVIIALSHLNEERLRRFWRQFAGRGWRDFMPVRRRT |
| Ga0209581_10033897 | 3300027706 | Surface Soil | MDPKLTLLFMLIGAVVVLSHLTDENLTRMRRQLVDRRWRQFVRLPRKF |
| Ga0209726_100981032 | 3300027815 | Groundwater | MDPKLTILFLLIGAIIVLSYLTEENLGRMRRQLVDRRWRKIMPLRRRS |
| Ga0209514_102767662 | 3300027819 | Groundwater | MDPKLTILFLLIGAIIVLSYLTEENLGRMRRQFVDRRWRKIMPLRRRS |
| Ga0209579_1000011250 | 3300027869 | Surface Soil | MDPKLTILFLLIGVVIALSNLTDDRLARLRRQLASRRWREFVPGRRKA |
| Ga0209068_107368021 | 3300027894 | Watersheds | TRWLLRKRLTMDPKLTILFMLIGAVIALSHMTEENLGRVRRQIVDRRWREFVPLRRRF |
| Ga0209048_100507481 | 3300027902 | Freshwater Lake Sediment | MDPKLTILFLLIGAVIALSHVSDENLGRMRRQFVSRRWREFVPLRRRS |
| Ga0209048_100511154 | 3300027902 | Freshwater Lake Sediment | MDSKLTILFMLVASIIVLSHLGEENLGRMRRQLVDRRWREWLPLRRQS |
| Ga0209048_104074792 | 3300027902 | Freshwater Lake Sediment | MDPKLTILFMLIGAVIGLSNLSEENLGRMRRQFVDRRWREFVPLRRRS |
| Ga0209415_103635822 | 3300027905 | Peatlands Soil | MDPKLTILFLLIGSVITLSHLNDDNLARMRRQFINRRWREFVPGWRKS |
| Ga0209583_104575782 | 3300027910 | Watersheds | MDPKLTMLFVLIGAVVVLSHLTDDNLTRVRRQLVDRRWRNFVRISRKI |
| Ga0209069_102380322 | 3300027915 | Watersheds | MDPKLGLLFLLIGAVIVLSHLSEENLGRVRRQLADGRWREIMPGRRRA |
| Ga0209168_103219052 | 3300027986 | Surface Soil | MDPKLTILILLIGTVIGLSHLSDDRLSRVRRQLAGRRWREIVPGWRKS |
| Ga0265338_103838032 | 3300028800 | Rhizosphere | MDPKLTILFLLIGSIITLSHLSDDNLARMRRQIISRRWREFVPGRRKS |
| Ga0311330_101264125 | 3300029945 | Bog | TAWRIFRGGLMDPKLTILFLLIGCVVGLSHLNEENMGRMRRQIANRNWREFVPLRRRT |
| Ga0075386_120152941 | 3300030916 | Soil | MDPKLGLLFLLIGTVIVLSHLSEENLGRVRRQLADRRWREIMPGRRRA |
| Ga0265330_103347102 | 3300031235 | Rhizosphere | MDPKLAMLFLLIGAVIALSNLSEENLGRMRRQFSGRRWREFVPGRRK |
| Ga0265325_1000026437 | 3300031241 | Rhizosphere | MDPKIGLLFLLIGTVIVLSHLSEETVGRVRRQLADRRWREIVPGRRRA |
| Ga0307506_104464542 | 3300031366 | Soil | MDPKIALLFLLIGAVIVLSHLSDENLGRMRRQLAERRWREFVPR |
| Ga0265342_103138301 | 3300031712 | Rhizosphere | MDPKLAMLFLLIGAVIALSNLSEENLGRMRRQFSGRRWREFVP |
| Ga0318493_106031132 | 3300031723 | Soil | IGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS |
| Ga0318566_101792181 | 3300031779 | Soil | MDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVP |
| Ga0302319_107544092 | 3300031788 | Bog | MDPKLTILFLLIGCVVGLSHLNEENLGRMRRQFVASRWRQFVPLRRKP |
| (restricted) Ga0255338_10084698 | 3300031825 | Sandy Soil | MDPKITLLFVLIATVIGLSYLTEENLGRLRRQFGQRRWRGFVPLRRRV |
| Ga0318522_103204672 | 3300031894 | Soil | FNRDRSMDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS |
| Ga0214473_102779142 | 3300031949 | Soil | MDPKLTMLFLLIGSVIVLSHLSDEKLGRMRRQLTSRNWREFVPRRRRV |
| Ga0308176_102098132 | 3300031996 | Soil | MDPKIGLLFLLIGAVIVLSHLSEENLGRVRRQLAGRRWREIMPGRRRV |
| Ga0318507_101723042 | 3300032025 | Soil | MDPKLTILFLLIGGIVALSHLNEENTQRVRRQLLARRWRNFVPGQRKS |
| Ga0318549_100263613 | 3300032041 | Soil | MDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRK |
| Ga0318506_105586601 | 3300032052 | Soil | HSWYAACIASNAAKWPLFNRDRSMDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS |
| Ga0318575_100240681 | 3300032055 | Soil | ILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKL |
| Ga0318514_106925172 | 3300032066 | Soil | WPLFNRDRSMDPKLTILFLLIGGIVALSHLNEENMQRVRRQLLARRWRNFVPGQRKS |
| Ga0335085_100071459 | 3300032770 | Soil | MDPKLALLFLLISSIVGLSHLDEDRWARVRRQFVSRRWREFVPGRRKF |
| Ga0335085_101238533 | 3300032770 | Soil | MDPKLTMLFLLISGVITLSHLNDENLDRVRRQLLARRWRNLVPGRRKS |
| Ga0335085_101677144 | 3300032770 | Soil | MDPKITMLFLLIGTVITLSNDDRLGRVRRQIAARGWRRFVRGPRKE |
| Ga0335085_108139802 | 3300032770 | Soil | MDPKLTILFMLIGAVVVLSHLTDDNLTRVRRQLIDRRWRNFVRISRKI |
| Ga0335085_109043172 | 3300032770 | Soil | KLTILFMLIGAVVVLSHLTDDNLTRVRQQLIDRRWRNFVRISRKI |
| Ga0335085_114058872 | 3300032770 | Soil | MDPKLTLLVLLISGIIALSHLTEENMQRVRRQLIARRWREFVPSRRKS |
| Ga0335085_117279272 | 3300032770 | Soil | MDPKLGLLFLLIGTVIVLSHLSEENLGRVRRQLAELRWREIVPGRRRA |
| Ga0335082_100526662 | 3300032782 | Soil | MDPKIALLFLLIGGIIVLSHLSNDGWGRVRRQLAERRWREFVPRRRRV |
| Ga0335082_108080922 | 3300032782 | Soil | MDPKLTILFLFIGAVIALSNLSDEKLARMRRQIAARRWRELVPGRRKI |
| Ga0335082_111950162 | 3300032782 | Soil | KLTMLFLLISGVITLSHLNDENLDRVRRQLLARRWRNLVPGRRKS |
| Ga0335079_103682192 | 3300032783 | Soil | MDPKLGILFVLISSIIALSHLDDDNLARMRRQLVNRRWREFVPGRRKS |
| Ga0335079_104081052 | 3300032783 | Soil | MDPKVTLLFFLIGSIIGLSHLNDDILNRMRRQLTDWRRRPLRRRI |
| Ga0335079_122165612 | 3300032783 | Soil | MDPKLALLFMLVSAIIALSHLTEENISRMRRQLAFRQWREFVPSRRKA |
| Ga0335079_122540381 | 3300032783 | Soil | MDPKLTILFMLITAVVVLSHLTDENISRMRRQLVERRWRNFVRLSRKI |
| Ga0335078_120934002 | 3300032805 | Soil | MDPKLTILFMLIGAVVVLSHLTDENLMRMRRQLVRPRWRNFVRMSRKI |
| Ga0335078_127450362 | 3300032805 | Soil | MDPKITMLFLLIGAVITLSNDDRLARVRRQIAASGWRGFVRGRRKD |
| Ga0335080_101220641 | 3300032828 | Soil | MDPKLTILFMLITAVVVLSHLTDENLTRMRQQLIARRWRKFVRIPRKI |
| Ga0335080_108993741 | 3300032828 | Soil | MDPKLTILFMLIGAVVVLSHLTDENLTRVRRQFVDRRWRNFVRISRKI |
| Ga0335080_115642032 | 3300032828 | Soil | LRGRKEAMDPKLTILFMLITAVVVLSHLTDENISRMRRQLVERRWRNFVRLSRKI |
| Ga0335081_100154965 | 3300032892 | Soil | MDPKLTLLFVLIGAVVALSHLNDESLTRMRRRLVDRRWRQFVRTSRKF |
| Ga0335081_100704794 | 3300032892 | Soil | MDPKLTMLFMLIGAVVVLSHLTEENLTRMRRQLVDRRWRNIVRTSRKN |
| Ga0335081_103058672 | 3300032892 | Soil | MDPKLTLLFMLIGAVVALSHLTDENLTRVRRQLIARRWRPFVRSSRKI |
| Ga0335081_104355832 | 3300032892 | Soil | MDPKLAILFLLVGAIIALSHLSEENIRRMRRQLIRLQWREFVPSRRKA |
| Ga0335081_106605362 | 3300032892 | Soil | MDPKLTMLFLLIGAVIVLSNLSEENLGRMRRQLSARRWREFVPGRRKV |
| Ga0335081_120452912 | 3300032892 | Soil | MDPKLTILFLLIGSIITLSHLSDDNLARMRRRFISRRWREFVLGWRKS |
| Ga0335069_121073391 | 3300032893 | Soil | KMDPKLAMLFLLIGAVIALSNLTEENLGRVRRQISARRWRGFVPGWRK |
| Ga0310811_107642222 | 3300033475 | Soil | MDPKITILFLLIGAIIALASLTDGNLERLRRQFSERGWRGFVPTRRRT |
| Ga0316620_111854142 | 3300033480 | Soil | MMDPKLTLLFLLIGSIVSFSHLNDEALARMTRQLVRRDWRDFMPRRRKH |
| Ga0316628_1000491852 | 3300033513 | Soil | MDPKLTILFLLIGSIITLSHLSDDNLARMRRQFISRRWRELVPGRRKS |
| Ga0316628_1028018621 | 3300033513 | Soil | PKLGLLFLLIGTVIVLSHLSEENLGRVRRQLAELRWREIVPGRRRV |
| Ga0316628_1036247312 | 3300033513 | Soil | MDPKLTILFLLIGSIITLSHLNDDTLARMRRQFIDRRWREFVPGRRKS |
| Ga0314871_015384_249_395 | 3300033809 | Peatland | MDPKIALLFVLIGTVIVLSHLSDENLGRVRRQLAAGRWREIVPRRRRA |
| Ga0370494_092104_556_702 | 3300034130 | Untreated Peat Soil | MDPKLTILVMLIGAIIALSHLNEENLGRMRRQLVGRRWREMMPLRRRS |
| Ga0370494_171860_123_269 | 3300034130 | Untreated Peat Soil | MDPKLTILFVLIACVIGMSHLTEENLGRMRRQLVNRSWREFVPSRRRI |
| Ga0370501_0347227_251_397 | 3300034195 | Untreated Peat Soil | MDPKLTILFMLIGAVIVLSHLTEENLGRMRRQFVDRRWREFVPSRRKA |
| Ga0373950_0037055_591_731 | 3300034818 | Rhizosphere Soil | MDPKLAVLFLLVGSVIVLSHLNEDNLGRMRRQFAARNWRQLVRRRV |
| ⦗Top⦘ |