NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017647

3300017647: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft OP (version 2)



Overview

Basic Information
IMG/M Taxon OID3300017647 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191730 | Ga0182748
Sample NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft OP (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size448939775
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis2
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001736Metagenome / Metatranscriptome644Y
F003648Metagenome / Metatranscriptome475Y
F008634Metagenome / Metatranscriptome330Y
F033176Metagenome / Metatranscriptome178Y
F071679Metagenome / Metatranscriptome122N
F084466Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0182748_1025409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2660Open in IMG/M
Ga0182748_1049574Not Available1511Open in IMG/M
Ga0182748_1132952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis669Open in IMG/M
Ga0182748_1146574All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
Ga0182748_1183910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis516Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0182748_1025409Ga0182748_10254092F008634MYGHGRELEVGNATSAILVSLLRTLIENSVLSNGDVRTLLTDAAATLAPHEYTAPFQGAIGIILEDILPKFPENGGD
Ga0182748_1049574Ga0182748_10495744F003648VWLPKERLMAMAASRCAVCSRAMVAALVEADPTDAALELRTFSCAECGHSR
Ga0182748_1085119Ga0182748_10851191F071679LYDYYFGEKGNALAVDPNGGLYPEVYINNMKTMVAQKNIDAVVPLEKLWDPRFVNAYLGNNGWYDNRTRKGGLALRELMRR
Ga0182748_1132952Ga0182748_11329522F001736MPEQYRRPHHHERVSNIERMKRAWEAEADALVTVREFNARLAEKRTVWFWPKIIAAVTAKHPWVSIVCDSCGGLTDLDLRMKPRDPEASIRVVLADVRCPRCNGHGRPRIVGLTQQATR
Ga0182748_1146574Ga0182748_11465742F084466MTARTAAFALVFWAAASAEAFAIASVNVYGLRAPEEISGFTLNDSTNFEKVKPGDGYGLDYSQSGWKLDVFIYDLKRAAIPDDAKSAIVRAEFERARADAYLAQPRGIYAQVYLRRNFTV
Ga0182748_1183910Ga0182748_11839102F033176MDPKITLLLVLIATVIGLSYLTEENIGRLRRQLDLGRWREFVPLRRRV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.