| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026132 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114514 | Gp0125958 | Ga0209921 |
| Sample Name | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 188857866 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Haloferacaceae → Haloplanus | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → wetland area → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South San Francisco, USA | |||||||
| Coordinates | Lat. (o) | 37.4973 | Long. (o) | -122.1295 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003128 | Metagenome | 506 | Y |
| F025653 | Metagenome / Metatranscriptome | 200 | Y |
| F078289 | Metagenome / Metatranscriptome | 116 | N |
| F084253 | Metagenome | 112 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209921_1009883 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| Ga0209921_1022599 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Haloferacaceae → Haloplanus | 1314 | Open in IMG/M |
| Ga0209921_1076343 | Not Available | 597 | Open in IMG/M |
| Ga0209921_1097959 | Not Available | 504 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209921_1009883 | Ga0209921_10098831 | F084253 | KAAQGFAVRRTSVRRNRKPAENAEQDKNGHLWMDTS |
| Ga0209921_1022599 | Ga0209921_10225995 | F003128 | MKLEVKATDVVEKKADDRGRITLGAKYAGKTVTVAV |
| Ga0209921_1076343 | Ga0209921_10763431 | F078289 | MKKTVIILMTLFIVVPLYGFNSLVRHEDIPKMRELGVSQEVIQYFISNQTSSVSSEDVIKMKQSGLKNDDIMSAIKSDLYRPEQKSTSMKEAELIAKLKESGMSDEAVLQFIQTVKSTRRVDSNGNMTQQYTNESQRTQYPTEGATFPKPDNYGYDPINGRFLLLVNPQN |
| Ga0209921_1097959 | Ga0209921_10979592 | F025653 | VKYFESKLKTMCLAELKNYRKRLDETIKQKIDQTAPNEQIAPLILYRGIVEHEITTRINKMKNQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |