


| Basic Information | |
|---|---|
| Family ID | F084253 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (33.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 0.00% Coil/Unstructured: 95.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF03109 | ABC1 | 7.14 |
| PF02769 | AIRS_C | 3.57 |
| PF04055 | Radical_SAM | 2.68 |
| PF08668 | HDOD | 2.68 |
| PF00037 | Fer4 | 2.68 |
| PF00072 | Response_reg | 1.79 |
| PF00582 | Usp | 1.79 |
| PF03781 | FGE-sulfatase | 1.79 |
| PF01326 | PPDK_N | 1.79 |
| PF07796 | DUF1638 | 1.79 |
| PF00027 | cNMP_binding | 1.79 |
| PF07992 | Pyr_redox_2 | 1.79 |
| PF13614 | AAA_31 | 1.79 |
| PF00809 | Pterin_bind | 1.79 |
| PF14574 | RACo_C_ter | 1.79 |
| PF05036 | SPOR | 1.79 |
| PF02518 | HATPase_c | 1.79 |
| PF07883 | Cupin_2 | 1.79 |
| PF04246 | RseC_MucC | 0.89 |
| PF13727 | CoA_binding_3 | 0.89 |
| PF01597 | GCV_H | 0.89 |
| PF02635 | DrsE | 0.89 |
| PF13635 | DUF4143 | 0.89 |
| PF14691 | Fer4_20 | 0.89 |
| PF13719 | zinc_ribbon_5 | 0.89 |
| PF08239 | SH3_3 | 0.89 |
| PF10589 | NADH_4Fe-4S | 0.89 |
| PF02423 | OCD_Mu_crystall | 0.89 |
| PF13439 | Glyco_transf_4 | 0.89 |
| PF03480 | DctP | 0.89 |
| PF13660 | DUF4147 | 0.89 |
| PF04060 | FeS | 0.89 |
| PF02754 | CCG | 0.89 |
| PF05015 | HigB-like_toxin | 0.89 |
| PF04324 | Fer2_BFD | 0.89 |
| PF03060 | NMO | 0.89 |
| PF01658 | Inos-1-P_synth | 0.89 |
| PF01264 | Chorismate_synt | 0.89 |
| PF07238 | PilZ | 0.89 |
| PF02954 | HTH_8 | 0.89 |
| PF00111 | Fer2 | 0.89 |
| PF12146 | Hydrolase_4 | 0.89 |
| PF13386 | DsbD_2 | 0.89 |
| PF03548 | LolA | 0.89 |
| PF01061 | ABC2_membrane | 0.89 |
| PF08448 | PAS_4 | 0.89 |
| PF01381 | HTH_3 | 0.89 |
| PF13187 | Fer4_9 | 0.89 |
| PF01250 | Ribosomal_S6 | 0.89 |
| PF00482 | T2SSF | 0.89 |
| PF03575 | Peptidase_S51 | 0.89 |
| PF01022 | HTH_5 | 0.89 |
| PF10418 | DHODB_Fe-S_bind | 0.89 |
| PF01709 | Transcrip_reg | 0.89 |
| PF00391 | PEP-utilizers | 0.89 |
| PF13167 | GTP-bdg_N | 0.89 |
| PF07662 | Nucleos_tra2_C | 0.89 |
| PF13240 | zinc_ribbon_2 | 0.89 |
| PF10050 | DUF2284 | 0.89 |
| PF00857 | Isochorismatase | 0.89 |
| PF00709 | Adenylsucc_synt | 0.89 |
| PF07963 | N_methyl | 0.89 |
| PF02589 | LUD_dom | 0.89 |
| PF00216 | Bac_DNA_binding | 0.89 |
| PF13193 | AMP-binding_C | 0.89 |
| PF00950 | ABC-3 | 0.89 |
| PF02581 | TMP-TENI | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 7.14 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 1.79 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.89 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.89 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.89 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.89 |
| COG0360 | Ribosomal protein S6 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.89 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.89 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.89 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.89 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.89 |
| COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 0.89 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.89 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.89 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.89 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.89 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.89 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.89 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG3086 | RseC, positive regulator of sigma E activity | Signal transduction mechanisms [T] | 0.89 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.89 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.96 % |
| Unclassified | root | N/A | 8.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004026|Ga0055443_10000074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5 | 5994 | Open in IMG/M |
| 3300004029|Ga0055442_10013775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 1700 | Open in IMG/M |
| 3300004050|Ga0055491_10019259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1325 | Open in IMG/M |
| 3300004050|Ga0055491_10120831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
| 3300004097|Ga0055584_101323357 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005182|Ga0069000_10038181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1036 | Open in IMG/M |
| 3300005182|Ga0069000_10057082 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005588|Ga0070728_10081182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1988 | Open in IMG/M |
| 3300005588|Ga0070728_10456946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 672 | Open in IMG/M |
| 3300005590|Ga0070727_10763253 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005601|Ga0070722_10003307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4322 | Open in IMG/M |
| 3300005601|Ga0070722_10415065 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005920|Ga0070725_10254095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 769 | Open in IMG/M |
| 3300005920|Ga0070725_10275565 | Not Available | 738 | Open in IMG/M |
| 3300006467|Ga0099972_12811978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 3928 | Open in IMG/M |
| 3300007102|Ga0102541_1058574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1346 | Open in IMG/M |
| 3300007102|Ga0102541_1258322 | Not Available | 641 | Open in IMG/M |
| 3300007764|Ga0102950_1002256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans | 5904 | Open in IMG/M |
| 3300007764|Ga0102950_1005092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 3845 | Open in IMG/M |
| 3300007764|Ga0102950_1018977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1885 | Open in IMG/M |
| 3300007784|Ga0102955_1045500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1052 | Open in IMG/M |
| 3300008410|Ga0115361_10018580 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300009033|Ga0102956_1005919 | All Organisms → cellular organisms → Bacteria | 3789 | Open in IMG/M |
| 3300009033|Ga0102956_1047588 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300009033|Ga0102956_1112016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300009033|Ga0102956_1292740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG9 | 560 | Open in IMG/M |
| 3300009035|Ga0102958_1003435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3737 | Open in IMG/M |
| 3300009035|Ga0102958_1007777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2629 | Open in IMG/M |
| 3300009035|Ga0102958_1047629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1246 | Open in IMG/M |
| 3300009035|Ga0102958_1106085 | Not Available | 881 | Open in IMG/M |
| 3300009035|Ga0102958_1117555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 842 | Open in IMG/M |
| 3300009035|Ga0102958_1238425 | Not Available | 616 | Open in IMG/M |
| 3300009060|Ga0102962_1031979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1534 | Open in IMG/M |
| 3300009060|Ga0102962_1047778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300009138|Ga0102959_1180399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 670 | Open in IMG/M |
| 3300009145|Ga0102961_1080250 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009145|Ga0102961_1112261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 704 | Open in IMG/M |
| 3300009145|Ga0102961_1113852 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009506|Ga0118657_10644195 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300010392|Ga0118731_111487871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 554 | Open in IMG/M |
| 3300010413|Ga0136851_10060376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4405 | Open in IMG/M |
| 3300010430|Ga0118733_100091418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6165 | Open in IMG/M |
| 3300019711|Ga0193993_1034174 | Not Available | 616 | Open in IMG/M |
| 3300022201|Ga0224503_10006017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3476 | Open in IMG/M |
| 3300022202|Ga0224498_10000016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 39105 | Open in IMG/M |
| 3300022202|Ga0224498_10003569 | All Organisms → cellular organisms → Bacteria | 4074 | Open in IMG/M |
| 3300022206|Ga0224499_10132057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
| 3300022217|Ga0224514_10034669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1667 | Open in IMG/M |
| 3300022217|Ga0224514_10120517 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300022218|Ga0224502_10002825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6274 | Open in IMG/M |
| 3300022306|Ga0224509_10025983 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300022306|Ga0224509_10039076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG10 | 1586 | Open in IMG/M |
| 3300022308|Ga0224504_10136069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1006 | Open in IMG/M |
| 3300025539|Ga0210109_1000289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9751 | Open in IMG/M |
| 3300025539|Ga0210109_1003197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2303 | Open in IMG/M |
| 3300025557|Ga0210141_1000671 | All Organisms → cellular organisms → Bacteria | 6196 | Open in IMG/M |
| 3300025557|Ga0210141_1002353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3707 | Open in IMG/M |
| 3300025557|Ga0210141_1098326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 556 | Open in IMG/M |
| 3300025561|Ga0210119_1003110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2982 | Open in IMG/M |
| 3300025566|Ga0210140_1005277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1946 | Open in IMG/M |
| 3300025583|Ga0210085_1119313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 712 | Open in IMG/M |
| 3300025615|Ga0210086_1096019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 881 | Open in IMG/M |
| 3300025615|Ga0210086_1221842 | Not Available | 541 | Open in IMG/M |
| 3300025797|Ga0210062_1008086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2787 | Open in IMG/M |
| 3300025797|Ga0210062_1027412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium 4572_32.1 | 1415 | Open in IMG/M |
| 3300025797|Ga0210062_1033148 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300025797|Ga0210062_1042262 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300025797|Ga0210062_1060322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 897 | Open in IMG/M |
| 3300025799|Ga0210122_1004375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4299 | Open in IMG/M |
| 3300025799|Ga0210122_1027618 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300025813|Ga0210064_1001270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10911 | Open in IMG/M |
| 3300025966|Ga0210105_1003560 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300025977|Ga0210072_1016245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 948 | Open in IMG/M |
| 3300026099|Ga0209920_1000366 | All Organisms → cellular organisms → Bacteria | 5055 | Open in IMG/M |
| 3300026099|Ga0209920_1011337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1171 | Open in IMG/M |
| 3300026099|Ga0209920_1039782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei | 601 | Open in IMG/M |
| 3300026106|Ga0209927_1002205 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300026126|Ga0209957_1025593 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300026131|Ga0209928_1007214 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300026132|Ga0209921_1009883 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300026133|Ga0209940_1003373 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300027758|Ga0209379_10215324 | Not Available | 659 | Open in IMG/M |
| 3300027820|Ga0209578_10489415 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027828|Ga0209692_10059296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1999 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10251286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 852 | Open in IMG/M |
| 3300027917|Ga0209536_101827789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19 | 732 | Open in IMG/M |
| 3300027967|Ga0209272_10021174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2599 | Open in IMG/M |
| 3300027978|Ga0209165_10027329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2022 | Open in IMG/M |
| 3300027978|Ga0209165_10318002 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031364|Ga0307445_10184179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 741 | Open in IMG/M |
| 3300031553|Ga0315547_1025959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2488 | Open in IMG/M |
| 3300031699|Ga0315535_1120701 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031727|Ga0316576_10023328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4308 | Open in IMG/M |
| 3300031733|Ga0316577_10373185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 810 | Open in IMG/M |
| 3300032062|Ga0315551_10034350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2797 | Open in IMG/M |
| 3300032231|Ga0316187_10211748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1495 | Open in IMG/M |
| 3300032258|Ga0316191_10538747 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300032258|Ga0316191_10791793 | Not Available | 687 | Open in IMG/M |
| 3300032258|Ga0316191_11191767 | Not Available | 550 | Open in IMG/M |
| 3300032258|Ga0316191_11277525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
| 3300032258|Ga0316191_11380223 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032260|Ga0316192_10659617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 706 | Open in IMG/M |
| 3300032276|Ga0316188_10146667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1174 | Open in IMG/M |
| 3300032276|Ga0316188_10782448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 526 | Open in IMG/M |
| 3300033291|Ga0307417_10061510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1550 | Open in IMG/M |
| 3300033429|Ga0316193_10302565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1269 | Open in IMG/M |
| 3300033429|Ga0316193_10349253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300033429|Ga0316193_10397637 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300033429|Ga0316193_10419542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300033429|Ga0316193_10814358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 743 | Open in IMG/M |
| 3300034782|Ga0373573_0068945 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300034782|Ga0373573_0076610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 949 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 25.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 23.21% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 12.50% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 8.93% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 8.04% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 4.46% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.79% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.79% |
| Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment | 1.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.79% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 1.79% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.89% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.89% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
| 3300008410 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC5T | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300025539 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025561 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025977 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026099 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026106 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026126 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026131 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026132 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026133 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
| 3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
| 3300032062 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90 | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300034782 | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055443_100000746 | 3300004026 | Natural And Restored Wetlands | AAQGFAVRRTPVRRSRKPAENADQGKKGHLWMDTHYERPVED* |
| Ga0055442_100137753 | 3300004029 | Natural And Restored Wetlands | NAAQGFAVRRTPVRRSRKPAENADQGKKGHLWMDTHYERPVED* |
| Ga0055491_100192592 | 3300004050 | Natural And Restored Wetlands | IFVLIKAAQGFAVRRTSVRRSRKLAENADQDKKVHLWMDTNLYFAPYKT* |
| Ga0055491_101208312 | 3300004050 | Natural And Restored Wetlands | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTC* |
| Ga0055584_1013233572 | 3300004097 | Pelagic Marine | FVLIKAAQGFAARRTSVRRSRKPAENAEQGKKGHLWMDTR* |
| Ga0069000_100381812 | 3300005182 | Natural And Restored Wetlands | FVLIKAAQGFAVRRTSVRRNRKPAENAEQDKDGHLWMDTN* |
| Ga0069000_100570822 | 3300005182 | Natural And Restored Wetlands | VLIKAAQEFAVPVHGTGSRTSVRRSRKPAENDEQDKKGHLWLVTSLQIEQKHP* |
| Ga0070728_100811823 | 3300005588 | Marine Sediment | MKRCGFFVLIKAAQGFVVRRTVVRRSRKPAENDDQGKKDHL* |
| Ga0070728_104569461 | 3300005588 | Marine Sediment | FVLIKAAQGFAVRRTSVRRSRKPAENADQDKKGHLWMDTS* |
| Ga0070727_107632533 | 3300005590 | Marine Sediment | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMDNSYMLDKYRCLMQ* |
| Ga0070722_100033072 | 3300005601 | Marine Sediment | IFVLIKAAQGFAARRTSVRRSRKPAENAEQDKKGHLWMDNS* |
| Ga0070722_104150652 | 3300005601 | Marine Sediment | VFVLIKAAQGVAVRRMSVRRSRKPAENTEQDKQGHLWMDNSYMLDKYRCLMQ* |
| Ga0070725_102540953 | 3300005920 | Marine Sediment | LIKAAQGFAVRRTPVRRSRKPAENAEQDKNGHLWMDNSYMLDKYRCLMQ* |
| Ga0070725_102755651 | 3300005920 | Marine Sediment | AVFVLIKAAQGFAARRTSVRRSRKPAENADQDKKGHF* |
| Ga0099972_128119781 | 3300006467 | Marine | QKLAIFVLIKAAQGFAVRLTPAHRNRKPAENAEQGKKGYLWMETN* |
| Ga0102541_10585741 | 3300007102 | Marine Sediment | AAQGFAVRRTSVRRSLKPAENAEQDKKGHLWMETS* |
| Ga0102541_12583222 | 3300007102 | Marine Sediment | MSNFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETNK |
| Ga0102950_10022561 | 3300007764 | Soil | LIKAAQGFAVRRTSVRRNRKPAENADQDKKGHLWMDTI* |
| Ga0102950_10050929 | 3300007764 | Soil | FVLIKAAQGFAVRRTSVRRSRKPAENADQDKKGHFWMGTS* |
| Ga0102950_10189771 | 3300007764 | Soil | IKAAQGFSVRRTSVHYSRKPAENAEQDEKGHLWMDTS* |
| Ga0102955_10455001 | 3300007784 | Soil | IFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETS* |
| Ga0115361_100185802 | 3300008410 | Sediment | IFVLIKAAQGFAVRRTPVRRSRKPAENAEQGKKGHLWMDTRQRG* |
| Ga0102956_10059194 | 3300009033 | Soil | IFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETN* |
| Ga0102956_10475881 | 3300009033 | Soil | IKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMGTN* |
| Ga0102956_11120162 | 3300009033 | Soil | LIKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMGTNLDRYSSS* |
| Ga0102956_12927402 | 3300009033 | Soil | IKAAQGFAVRRTSVRRSRKPAENADQDKNGHLWMGTK* |
| Ga0102958_10034356 | 3300009035 | Soil | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETS* |
| Ga0102958_10077771 | 3300009035 | Soil | IFVLIKAAQGFAVRRTSVRRNRKPAENAEQDKNGHLWMDTN* |
| Ga0102958_10476292 | 3300009035 | Soil | IFVLIKAAQGFAVRRTSVRRNRKPAENAEQDKNGHLWMDTS* |
| Ga0102958_11060851 | 3300009035 | Soil | AAQGFAVQRTSVRCSRKPAENAEQDKKGHLWMDTK* |
| Ga0102958_11175553 | 3300009035 | Soil | VLIKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMDTN* |
| Ga0102958_12384251 | 3300009035 | Soil | AQGFVVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTN* |
| Ga0102962_10319791 | 3300009060 | Soil | IFVLIKAAQGFAVRRTSVRRSRKPAENADQDKNGHLWMGNS* |
| Ga0102962_10477784 | 3300009060 | Soil | VLIKAAQGFAVRRTSVRRSRKPAENADQDKNGHLWMGTS* |
| Ga0102959_11803992 | 3300009138 | Soil | IFVRIKAAQGFSARHTPVCRSRKSAENADPGKKGHLWMETG* |
| Ga0102961_10802502 | 3300009145 | Soil | KAAQGFAVRRTSVRRRRKRAENADQDKNGHLWMDTS* |
| Ga0102961_11122611 | 3300009145 | Soil | IFVLIKAAQGFAVRRTSVRRSRKPAENADQDKKGHFWMDTI* |
| Ga0102961_11138522 | 3300009145 | Soil | MQKLAIFVLIKAAQGFAVRRTPVRRSRNPAENAEQGKKGYFRMETD* |
| Ga0118657_106441951 | 3300009506 | Mangrove Sediment | AAQGFAVRRTSVRRSRKPAENTDQDKKGHLWIGH* |
| Ga0118731_1114878712 | 3300010392 | Marine | KAAQGFAVRRTSVRRSRKPAENADQDKKGHLWMDTS* |
| Ga0136851_100603767 | 3300010413 | Mangrove Sediment | KAAQGFTVRRTPVRRSREPAENAYQGKKGHLWMDTN* |
| Ga0118733_1000914187 | 3300010430 | Marine Sediment | IFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTN* |
| Ga0193993_10341742 | 3300019711 | Sediment | AAQGFAVRRTSVRRSRKPAENTEQDKNGHLWMDTK |
| Ga0224503_100060176 | 3300022201 | Sediment | AAQGFVVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0224498_100000161 | 3300022202 | Sediment | KAAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTNYLRV |
| Ga0224498_100035694 | 3300022202 | Sediment | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETN |
| Ga0224499_101320571 | 3300022206 | Sediment | LIKAAQGFAISAHGTGRRMSLRRSRKPAENADQDKNGHLWMDTSYD |
| Ga0224514_100346691 | 3300022217 | Sediment | KAAQGFAVSRTSVRRSRKPAENAEQDKKSHLWMDTN |
| Ga0224514_101205173 | 3300022217 | Sediment | IKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTNYD |
| Ga0224502_100028258 | 3300022218 | Sediment | QKLAIFVLIKAAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKNGHLWMDTN |
| Ga0224509_100259831 | 3300022306 | Sediment | AQGFAVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTNYD |
| Ga0224509_100390761 | 3300022306 | Sediment | AQGFVVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0224504_101360691 | 3300022308 | Sediment | IFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETS |
| Ga0210109_100028911 | 3300025539 | Natural And Restored Wetlands | FVLIKAAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKKSHLWMDTN |
| Ga0210109_10031971 | 3300025539 | Natural And Restored Wetlands | IKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETS |
| Ga0210141_10006711 | 3300025557 | Natural And Restored Wetlands | FVLIKAAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKNGHLWMDTT |
| Ga0210141_10023531 | 3300025557 | Natural And Restored Wetlands | FVLIKAAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0210141_10983261 | 3300025557 | Natural And Restored Wetlands | KAAQGFTARRTSVRRSRKPAENADQDKKGYFWMVTNSFCELQQTC |
| Ga0210119_10031101 | 3300025561 | Natural And Restored Wetlands | AAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETS |
| Ga0210140_10052773 | 3300025566 | Natural And Restored Wetlands | LINAAQGFAVRRTPVRRSRKPAENADQGKKGHLWMDTHYERPVED |
| Ga0210085_11193132 | 3300025583 | Natural And Restored Wetlands | AIFVLIKAAQGFAVRRTSVRRNRKPAENADQDKKGHLWMDTI |
| Ga0210086_10960192 | 3300025615 | Natural And Restored Wetlands | VLIKAAQGFSVRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0210086_12218421 | 3300025615 | Natural And Restored Wetlands | VFVLIKAAQGFAARRTSVRRSRKPAENADQDKKGHF |
| Ga0210062_10080863 | 3300025797 | Natural And Restored Wetlands | FVLIKAAQGFAMRRTSVRRSRKPAENAEQDKNGNLWMGTN |
| Ga0210062_10274123 | 3300025797 | Natural And Restored Wetlands | FVLIKAAQGFSVRRTSVRRSRKPAENAEQDKKGYLWMDTK |
| Ga0210062_10331483 | 3300025797 | Natural And Restored Wetlands | FVLIKAAQGFSVRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0210062_10422621 | 3300025797 | Natural And Restored Wetlands | LIKAAQGFAVRRTSVRRSRKPAENADQDKKGHLWMGTN |
| Ga0210062_10603221 | 3300025797 | Natural And Restored Wetlands | AAQGFAVPAHGTGRRTSVRRSRKPAENAEQDKKGHLWMDTS |
| Ga0210122_10043751 | 3300025799 | Natural And Restored Wetlands | VLIKAAQGFSVRRTSVRRSRKPAENAEQDKNGHIWMDTK |
| Ga0210122_10276181 | 3300025799 | Natural And Restored Wetlands | VLIKAAQGFSVRRTSVRRSRKPAENAEQDKNGHLWMDTN |
| Ga0210064_10012701 | 3300025813 | Natural And Restored Wetlands | AIFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMGTNYKSPRF |
| Ga0210105_10035604 | 3300025966 | Natural And Restored Wetlands | IFVLIKAAQGFVVRRTSVRRSRKPAENAERDKKSHLWMGTN |
| Ga0210072_10162452 | 3300025977 | Natural And Restored Wetlands | SNFVLIKAAQGFAISAHGTGRRMSLRRSRKPAENADQDKNGHLWMDTSYD |
| Ga0209920_10003661 | 3300026099 | Soil | AAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTNYD |
| Ga0209920_10113371 | 3300026099 | Soil | AVFVLIKAAQGFVVRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0209920_10397821 | 3300026099 | Soil | AIFVWIKAAQGFSVRHTSCMPHRKPAENADPGKKGHLWMETN |
| Ga0209927_10022053 | 3300026106 | Soil | IKAAQEFAVRRTSVRRSRKPAENAEQDKKGHLWMETN |
| Ga0209957_10255931 | 3300026126 | Soil | KAAQEFAVRRTSVRRSRKPAENAEQDKKGHLWMETN |
| Ga0209928_10072141 | 3300026131 | Soil | KAALVFAVRRTSVRRSRKPAENAEQDKKGHLWMETN |
| Ga0209921_10098831 | 3300026132 | Soil | KAAQGFAVRRTSVRRNRKPAENAEQDKNGHLWMDTS |
| Ga0209940_10033731 | 3300026133 | Soil | KAALVLAVRRTSVRRSRKPAENAEQDKKGHLWMETN |
| Ga0209379_102153242 | 3300027758 | Marine Sediment | KAAQGFAARRTSVRRSREPAENADQDKKGHFRIGN |
| Ga0209578_104894151 | 3300027820 | Marine Sediment | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKNGHLWMDNSYMLDKYRCLMQ |
| Ga0209692_100592962 | 3300027828 | Marine Sediment | AIFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTS |
| (restricted) Ga0255053_102512863 | 3300027868 | Seawater | AIFVLIKAAQGFSVRRTSVRRSRKPAENAEQGKKGHLWMETG |
| Ga0209536_1018277891 | 3300027917 | Marine Sediment | AIFVLIKPAQGFAVRRTSVRRSRKPAENADPDKKGHLWMGTI |
| Ga0209272_100211741 | 3300027967 | Marine Sediment | VLIKAAQGFAVRRTPVRRSRKPAENAEQDKNGHLWMDNSYMLDKYRCLMQ |
| Ga0209165_100273293 | 3300027978 | Marine Sediment | VIADYGFAVRRTPVRRSRKPAENAEQGKKSYFWMDTN |
| Ga0209165_103180021 | 3300027978 | Marine Sediment | VFVLIKAAQGVAVRRMSVRRSRKPAENTEQDKQGHLWMDNSYMLDKYRCLMQ |
| Ga0307445_101841791 | 3300031364 | Salt Marsh | AIFVLIKAAQGFAVRRTSVRRSRKPAENADQDKKGHLWMDNS |
| Ga0315547_10259591 | 3300031553 | Salt Marsh Sediment | KAAQGVAVRRTSVRRNGKPAENADQDKKGHLWMDTS |
| Ga0315535_11207011 | 3300031699 | Salt Marsh Sediment | NLYWTQIKLNKFPMQKLAIFVLIKAAQGFAVRRTPVRRSRNPAENAEQGKKGYFRMETD |
| Ga0316576_100233283 | 3300031727 | Rhizosphere | MGIFVLIKAAQGFAVRRTSVRRSRKPAENADQDKDGHFWMGTN |
| Ga0316577_103731851 | 3300031733 | Rhizosphere | KAAQGFSARRTSVRRNRKPAENADQDKKGHFWMDTIY |
| Ga0315551_100343503 | 3300032062 | Salt Marsh Sediment | ITCPIQKGAIFVLIKAAQGVAVRRTSVRRNGKPAENADQDKKGHLWMDTS |
| Ga0316187_102117483 | 3300032231 | Worm Burrow | QGFAVRRTSVRRSRKPAENAEQDKKGHLWMDNSYMLDKYRCLMQ |
| Ga0316191_105387471 | 3300032258 | Worm Burrow | AAQGFAVRRKSVRRSRKPAENAEQDKNCHLWMDTNYLRV |
| Ga0316191_107917931 | 3300032258 | Worm Burrow | AAQGFAVRRTPVHRNRKPAENAEQGKKGYLWMETN |
| Ga0316191_111917671 | 3300032258 | Worm Burrow | LIKAAQGFVVRRTPVRRSRKPAENADQGQIDYFWPDKRPRFCAISIIC |
| Ga0316191_112775251 | 3300032258 | Worm Burrow | FVLIKAAQGFAVRRTSVRRNRKPAENADQGKKGYFWMETN |
| Ga0316191_113802232 | 3300032258 | Worm Burrow | IFVLIKAAQGFSLRRTPVRRSRKPEENTEQDKKGHLWMGTN |
| Ga0316192_106596172 | 3300032260 | Worm Burrow | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTS |
| Ga0316188_101466672 | 3300032276 | Worm Burrow | IFVLIKAAQGFSVRRTSVRRSRKPAENAEQDKNGHLWMDTSSLLI |
| Ga0316188_107824482 | 3300032276 | Worm Burrow | MSKAAQGFAMRRTDVRRNRKPAENADQGKKDHFGIGHYM |
| Ga0307417_100615101 | 3300033291 | Salt Marsh | IFVLIKAAQGFSVRRTSVRRSRKPAENADQDKKNHL |
| Ga0316193_103025651 | 3300033429 | Sediment | FVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDTN |
| Ga0316193_103492534 | 3300033429 | Sediment | ATFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMDNSYMLDKYRCVMQ |
| Ga0316193_103976371 | 3300033429 | Sediment | FVLIKATQRFAARRTSVRRSREPAENADQDKKGHF |
| Ga0316193_104195421 | 3300033429 | Sediment | FVLIKAAQGFSVRRTSVRRSRKPAENAEQDKNRHLWMDTN |
| Ga0316193_108143581 | 3300033429 | Sediment | VFVLIKAAQGFSVRRTSVRRSRKPAENAEQDKKSHLWMDTN |
| Ga0373573_0068945_3_113 | 3300034782 | Sediment | KAAQGFAVRRTTVRRSRKPAENAEQGKKGHLWMDNS |
| Ga0373573_0076610_2_136 | 3300034782 | Sediment | TAQGFAFLAHGTGRRRPVRRHRKTAENAEQGKKDHLWMDTSLHL |
| ⦗Top⦘ |