NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013860

3300013860: Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3 SAF170 SPAdes reassembly



Overview

Basic Information
IMG/M Taxon OID3300013860 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095512 | Gp0111873 | Ga0181456
Sample NameClean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3 SAF170 SPAdes reassembly
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12258806
Sequencing Scaffolds8
Novel Protein Genes10
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB038B1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameClean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationUSA: Jet Propulsion Laboratory, Pasadena, California
CoordinatesLat. (o)34.1Long. (o)-118.1Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003133Metagenome / Metatranscriptome505Y
F017428Metagenome240Y
F028713Metagenome / Metatranscriptome190Y
F034461Metagenome / Metatranscriptome174Y
F046363Metagenome / Metatranscriptome151Y
F065766Metagenome / Metatranscriptome127Y
F072954Metagenome / Metatranscriptome120Y
F093243Metagenome / Metatranscriptome106Y
F100750Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0181456_100061Not Available12733Open in IMG/M
Ga0181456_100074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11754Open in IMG/M
Ga0181456_100125Not Available10044Open in IMG/M
Ga0181456_100227All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7743Open in IMG/M
Ga0181456_100428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5557Open in IMG/M
Ga0181456_100946All Organisms → cellular organisms → Bacteria2695Open in IMG/M
Ga0181456_101741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1307Open in IMG/M
Ga0181456_104086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB038B574Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0181456_100061Ga0181456_1000619F028713VRDMIEDKKVLLVKVDTLKNTADALTKSVSSEKFSCCRETMGISGLKND*
Ga0181456_100074Ga0181456_10007417F100750MEHIEDFQKLNVRVKYIPKEHRIDVFIWTLKDNIQHEDLLWEPDSLEKELRLARKMERKIMATRKPTTHNYKEGSVVSPSLPQPTRLTPQKLEEKKEKELCYNCDNKYTKVISVLRRNYFT*
Ga0181456_100125Ga0181456_1001259F034461MLGYDLDIIYRKGKKIFVADALSRKDGDVEALFCAISIIQLDWINEARDEWKKDKEVWPLIQKL*
Ga0181456_100227Ga0181456_10022710F046363MVLDASACINMYCNIERKIMKNQVGSPSFRVQGKISVHMCFMCYALALFIFFV*
Ga0181456_100227Ga0181456_1002272F046363MVLDASTCINMYFNIERNIMKNQAGSPGFGIQGKISVHMCFMYYALTLFIFFV*
Ga0181456_100313Ga0181456_1003134F072954LQQTREEVYQRTQVLQHKLKKIFDKRTKAEDFFMENKVLRWDSRREDKGKHGKFDFLWKGPYIIHVVQGNNTYFLKSLDGTNTEEGLVNGRMLKHYFDPL*
Ga0181456_100428Ga0181456_1004283F093243MLLSYIPTEDQDDDILMKALTRSKFEYHQGRIGVFDNPYLVEREC*
Ga0181456_100946Ga0181456_1009462F003133MSEGIDKSEGRKGAAKLLGGRISCIVGILFGVGGILFALLDASANVSAGAVGAALGVLGYFFGARRLGAATIVLGVIAVFFMAAAATGLIPGVEPLGHGYD*
Ga0181456_101741Ga0181456_1017412F065766MGKEKKGEGVGDPIKILFKEALEKQRNAMMEKNS*
Ga0181456_104086Ga0181456_1040861F017428QLRKANQKKILPMGRLQGVIVDIEGVSMQTNFEVIEIVDDSNPYPTLLGIDWATDMNGIINLKRQKMMLENKSLWVIVPLDLVEGERYTEPMCNEESDDDVDCIY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.