


| Basic Information | |
|---|---|
| Family ID | F093243 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVADNPYLVEREC |
| Number of Associated Samples | 49 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 64.15 % |
| % of genes near scaffold ends (potentially truncated) | 32.08 % |
| % of genes from short scaffolds (< 2000 bps) | 77.36 % |
| Associated GOLD sequencing projects | 45 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.887 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room (34.906 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.509 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) (34.906 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF07727 | RVT_2 | 19.81 |
| PF14223 | Retrotran_gag_2 | 1.89 |
| PF00665 | rve | 1.89 |
| PF13976 | gag_pre-integrs | 1.89 |
| PF00098 | zf-CCHC | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.89 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.89 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.89 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.89 % |
| All Organisms | root | All Organisms | 48.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300008093|Ga0100393_10399630 | Not Available | 637 | Open in IMG/M |
| 3300008095|Ga0100392_1462090 | Not Available | 553 | Open in IMG/M |
| 3300009144|Ga0058702_10275768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 671 | Open in IMG/M |
| 3300009144|Ga0058702_10316751 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 628 | Open in IMG/M |
| 3300009853|Ga0118741_1018098 | Not Available | 606 | Open in IMG/M |
| 3300009853|Ga0118741_1018380 | Not Available | 603 | Open in IMG/M |
| 3300010395|Ga0058701_10693849 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora → Moniliophthora perniciosa | 559 | Open in IMG/M |
| 3300012056|Ga0153925_1021214 | Not Available | 648 | Open in IMG/M |
| 3300012076|Ga0153971_1051176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 737 | Open in IMG/M |
| 3300012076|Ga0153971_1053410 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Ginkgoopsida → Ginkgoidae → Ginkgoales → Ginkgoaceae → Ginkgo → Ginkgo biloba | 718 | Open in IMG/M |
| 3300012076|Ga0153971_1090067 | Not Available | 525 | Open in IMG/M |
| 3300012649|Ga0118321_115535 | Not Available | 549 | Open in IMG/M |
| 3300013285|Ga0136642_1150215 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 580 | Open in IMG/M |
| 3300013860|Ga0181456_100428 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 5557 | Open in IMG/M |
| 3300013862|Ga0181459_100523 | Not Available | 8802 | Open in IMG/M |
| 3300013862|Ga0181459_101479 | Not Available | 4874 | Open in IMG/M |
| 3300013864|Ga0181472_102958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 3615 | Open in IMG/M |
| 3300013864|Ga0181472_115596 | Not Available | 606 | Open in IMG/M |
| 3300013865|Ga0181471_100526 | Not Available | 11866 | Open in IMG/M |
| 3300013865|Ga0181471_100618 | Not Available | 10653 | Open in IMG/M |
| 3300013866|Ga0181473_100532 | All Organisms → cellular organisms → Bacteria | 9708 | Open in IMG/M |
| 3300013866|Ga0181473_101746 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 6274 | Open in IMG/M |
| 3300013866|Ga0181473_102001 | All Organisms → cellular organisms → Eukaryota | 5864 | Open in IMG/M |
| 3300013866|Ga0181473_106129 | All Organisms → cellular organisms → Eukaryota | 2416 | Open in IMG/M |
| 3300013866|Ga0181473_107259 | Not Available | 1917 | Open in IMG/M |
| 3300013866|Ga0181473_107696 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 1778 | Open in IMG/M |
| 3300013866|Ga0181473_107857 | All Organisms → cellular organisms → Eukaryota | 1725 | Open in IMG/M |
| 3300013866|Ga0181473_109358 | Not Available | 1343 | Open in IMG/M |
| 3300013866|Ga0181473_112300 | All Organisms → cellular organisms → Eukaryota | 931 | Open in IMG/M |
| 3300013868|Ga0181469_102619 | Not Available | 5871 | Open in IMG/M |
| 3300013868|Ga0181469_104066 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea | 3692 | Open in IMG/M |
| 3300013868|Ga0181469_104926 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 2923 | Open in IMG/M |
| 3300013868|Ga0181469_105379 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 2610 | Open in IMG/M |
| 3300013868|Ga0181469_108982 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1420 | Open in IMG/M |
| 3300013868|Ga0181469_115385 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 809 | Open in IMG/M |
| 3300013869|Ga0181468_101226 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 4890 | Open in IMG/M |
| 3300013869|Ga0181468_101605 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 4004 | Open in IMG/M |
| 3300013870|Ga0181465_102828 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca | 6126 | Open in IMG/M |
| 3300013870|Ga0181465_126658 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 522 | Open in IMG/M |
| 3300013872|Ga0181463_1000054 | Not Available | 21106 | Open in IMG/M |
| 3300013872|Ga0181463_1003453 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 3728 | Open in IMG/M |
| 3300013872|Ga0181463_1017466 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 988 | Open in IMG/M |
| 3300013873|Ga0181464_1000069 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 28065 | Open in IMG/M |
| 3300013873|Ga0181464_1001735 | Not Available | 10908 | Open in IMG/M |
| 3300013873|Ga0181464_1004089 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 6610 | Open in IMG/M |
| 3300013873|Ga0181464_1010248 | Not Available | 2900 | Open in IMG/M |
| 3300013873|Ga0181464_1022646 | Not Available | 1343 | Open in IMG/M |
| 3300013873|Ga0181464_1027193 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 1140 | Open in IMG/M |
| 3300013873|Ga0181464_1062772 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 567 | Open in IMG/M |
| 3300013873|Ga0181464_1065378 | Not Available | 549 | Open in IMG/M |
| 3300015277|Ga0182128_1023289 | Not Available | 712 | Open in IMG/M |
| 3300015277|Ga0182128_1028632 | Not Available | 673 | Open in IMG/M |
| 3300015291|Ga0182125_1024697 | Not Available | 742 | Open in IMG/M |
| 3300015291|Ga0182125_1058890 | Not Available | 581 | Open in IMG/M |
| 3300015294|Ga0182126_1003568 | Not Available | 1265 | Open in IMG/M |
| 3300015303|Ga0182123_1061805 | Not Available | 578 | Open in IMG/M |
| 3300015307|Ga0182144_1061237 | Not Available | 600 | Open in IMG/M |
| 3300015315|Ga0182120_1123922 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 527 | Open in IMG/M |
| 3300015321|Ga0182127_1010541 | Not Available | 1045 | Open in IMG/M |
| 3300015324|Ga0182134_1051966 | Not Available | 746 | Open in IMG/M |
| 3300015332|Ga0182117_1014622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 1232 | Open in IMG/M |
| 3300015332|Ga0182117_1030469 | Not Available | 979 | Open in IMG/M |
| 3300015340|Ga0182133_1070843 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 761 | Open in IMG/M |
| 3300015361|Ga0182145_1004523 | Not Available | 1584 | Open in IMG/M |
| 3300015361|Ga0182145_1108420 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 612 | Open in IMG/M |
| 3300018466|Ga0190268_11435654 | Not Available | 594 | Open in IMG/M |
| 3300020586|Ga0213497_1003111 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 1476 | Open in IMG/M |
| 3300020588|Ga0213495_10017745 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 849 | Open in IMG/M |
| 3300020590|Ga0213496_10089737 | Not Available | 506 | Open in IMG/M |
| 3300020600|Ga0213498_10033710 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 741 | Open in IMG/M |
| 3300020816|Ga0214090_10471855 | Not Available | 686 | Open in IMG/M |
| 3300020816|Ga0214090_10858060 | Not Available | 523 | Open in IMG/M |
| 3300020816|Ga0214090_10875204 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 1403 | Open in IMG/M |
| 3300020816|Ga0214090_10910679 | Not Available | 781 | Open in IMG/M |
| 3300020817|Ga0214258_10448692 | Not Available | 848 | Open in IMG/M |
| 3300020817|Ga0214258_11123526 | Not Available | 614 | Open in IMG/M |
| 3300022728|Ga0224566_106858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 662 | Open in IMG/M |
| 3300023280|Ga0255813_10091165 | Not Available | 540 | Open in IMG/M |
| 3300023280|Ga0255813_10965120 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 661 | Open in IMG/M |
| 3300023280|Ga0255813_10981198 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 916 | Open in IMG/M |
| 3300023280|Ga0255813_11169167 | Not Available | 797 | Open in IMG/M |
| 3300023291|Ga0256703_10384167 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 609 | Open in IMG/M |
| 3300023291|Ga0256703_10595860 | Not Available | 751 | Open in IMG/M |
| 3300023291|Ga0256703_10744158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 535 | Open in IMG/M |
| 3300023291|Ga0256703_10756996 | Not Available | 649 | Open in IMG/M |
| 3300023291|Ga0256703_10765095 | Not Available | 644 | Open in IMG/M |
| 3300023300|Ga0256702_11176570 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 615 | Open in IMG/M |
| 3300023300|Ga0256702_11316432 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies | 961 | Open in IMG/M |
| 3300023300|Ga0256702_11579059 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 711 | Open in IMG/M |
| 3300023300|Ga0256702_11650295 | Not Available | 553 | Open in IMG/M |
| 3300023300|Ga0256702_12255748 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 705 | Open in IMG/M |
| 3300023300|Ga0256702_12280602 | Not Available | 520 | Open in IMG/M |
| 3300023300|Ga0256702_12434455 | Not Available | 615 | Open in IMG/M |
| 3300023300|Ga0256702_12719338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 587 | Open in IMG/M |
| 3300027652|Ga0209007_1016153 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1940 | Open in IMG/M |
| 3300030495|Ga0268246_10203116 | Not Available | 590 | Open in IMG/M |
| 3300031355|Ga0307421_1135866 | Not Available | 767 | Open in IMG/M |
| 3300031708|Ga0310686_102113560 | Not Available | 690 | Open in IMG/M |
| 3300031708|Ga0310686_107084035 | Not Available | 508 | Open in IMG/M |
| 3300031708|Ga0310686_111750662 | Not Available | 510 | Open in IMG/M |
| 3300031708|Ga0310686_111983342 | Not Available | 566 | Open in IMG/M |
| 3300032551|Ga0321339_1129350 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 563 | Open in IMG/M |
| 3300032591|Ga0214484_1088673 | Not Available | 644 | Open in IMG/M |
| 3300032591|Ga0214484_1104712 | Not Available | 579 | Open in IMG/M |
| 3300032698|Ga0214485_1084285 | Not Available | 603 | Open in IMG/M |
| 3300033545|Ga0316214_1000143 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca | 6333 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 34.91% |
| Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 21.70% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 9.43% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.77% |
| Leaf | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf | 3.77% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 3.77% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 1.89% |
| Wood Falls | Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.94% |
| Human Skin | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin | 0.94% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300008093 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17 | Environmental | Open in IMG/M |
| 3300008095 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-16 | Environmental | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300009853 | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3EC | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300012056 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaG | Host-Associated | Open in IMG/M |
| 3300012076 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA055 MetaG | Host-Associated | Open in IMG/M |
| 3300012649 | Human skin bacterial and viral communities - University of Pennsylvania - MG100605 | Host-Associated | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013860 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013862 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2P SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013864 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In1P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013865 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5p-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013866 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In2P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013868 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013869 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013870 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013872 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013873 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300020586 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_3 | Host-Associated | Open in IMG/M |
| 3300020588 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1 | Host-Associated | Open in IMG/M |
| 3300020590 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_2 | Host-Associated | Open in IMG/M |
| 3300020600 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_4 | Host-Associated | Open in IMG/M |
| 3300020816 | Food waste microbial community from Durham, Ontario, Canada - FW1 megahit | Engineered | Open in IMG/M |
| 3300020817 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahit | Engineered | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300023280 | Combined Assembly of Gp0238881, Gp0242115 | Engineered | Open in IMG/M |
| 3300023291 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119 | Engineered | Open in IMG/M |
| 3300023300 | Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100 | Engineered | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030495 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300031355 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-70 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0100393_103996301 | 3300008093 | Aquifer | MLLSYIPTEDQDVDILTKALTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0100392_14620902 | 3300008095 | Aquifer | MLLSYIPTEDQDVDMLTKALTRSKFEYHRGRIGVADNPYLVEREF* |
| Ga0058702_102757682 | 3300009144 | Agave | MLLQYIPTEDQDADILMKVLTRSKFEYHRGRIGVADNSYPVEREC* |
| Ga0058702_103167511 | 3300009144 | Agave | MLLKYIPKEDQDADILTKALTRRKFEYHRGRIGVKDNPYLVEREC* |
| Ga0118741_10180981 | 3300009853 | Wood Falls | YIPMEDHDANIMTKALTRRKFEYHRGRTRVVDNPYLFEREC* |
| Ga0118741_10183801 | 3300009853 | Wood Falls | MEDQDVDILTKALTRRKFEYHRGRIAVANNPYLVEREC* |
| Ga0058701_106938491 | 3300010395 | Agave | YHHIRDCVQRKIMLLSYIPTEDQDADILTKALTKSQFEYHRGRIAVDDNPYLVEREC* |
| Ga0153925_10212141 | 3300012056 | Attine Ant Fungus Gardens | MLLSYIPMEDQDADILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0153971_10511762 | 3300012076 | Attine Ant Fungus Gardens | MLLSYIPTEDQDANILTKALTRRKFEYHRGRIGVADNPYLVER |
| Ga0153971_10534101 | 3300012076 | Attine Ant Fungus Gardens | MLLSYIPMEDQDVDILTKALTRSKFEYHRGKIGVADNPYLVEREF* |
| Ga0153971_10900671 | 3300012076 | Attine Ant Fungus Gardens | QDADILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0118321_1155351 | 3300012649 | Human Skin | RRIMMLSYVPTEDQDADILTKALTRSKFEFHRGRIGVADNPYLAEREC* |
| Ga0136642_11502151 | 3300013285 | Freshwater | MLLSYIPTEDQDADILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0181456_1004283 | 3300013860 | Clean Room | MLLSYIPTEDQDDDILMKALTRSKFEYHQGRIGVFDNPYLVEREC* |
| Ga0181459_10052312 | 3300013862 | Clean Room | MLLSYIPTEDQDADILTKVLTRSKLEYHQGRIGVANNPYLVEREC* |
| Ga0181459_1014799 | 3300013862 | Clean Room | MLLSYIPMEDQDADILTKALTKRKFEYHRGKIGVADNPYLVENSTR* |
| Ga0181472_1029582 | 3300013864 | Clean Room | MLLSYIPMEDQDADILTKALTRSKFEYHQDRIGVADNPYLVEREC* |
| Ga0181472_1155961 | 3300013864 | Clean Room | YIPTEDQDADILTKALTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0181471_1005268 | 3300013865 | Clean Room | MLLSYIPMEDQDADILTKALTRSKFEYHKGKLGVANNPYLVEREC* |
| Ga0181471_10061810 | 3300013865 | Clean Room | MLLSYIPTKDQNADILTKALTRRKFEYHRGRIGVADNPYFVEREC* |
| Ga0181473_10053213 | 3300013866 | Clean Room | MLLSYIPTEDQDVDILTKALTRRKFEYHKGRIGVVDNPYLVEREC* |
| Ga0181473_1017464 | 3300013866 | Clean Room | MLLSYIPTEDQDVDILTKALTWSKFEYHQGRIGVADNPYLLEREC* |
| Ga0181473_1020015 | 3300013866 | Clean Room | MLLSYIPTEDQDADILMKALTRSKFEYHRGKIGVADNPYLVERDC* |
| Ga0181473_1061292 | 3300013866 | Clean Room | MLLSYIPTEDQDADILTKALTMGKFEYHRGRIGVADNPYLVEREC* |
| Ga0181473_1072592 | 3300013866 | Clean Room | MLLSYIPTEDQDADILTKALTMRKFEYHQGRIRVADNPYLVEREC* |
| Ga0181473_1076961 | 3300013866 | Clean Room | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVADNXXXXS* |
| Ga0181473_1078571 | 3300013866 | Clean Room | MLLSYIPMEDQDVDILTKALTRSKFEYHRGRIGIADNPYLVEREC* |
| Ga0181473_1093583 | 3300013866 | Clean Room | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIRVADNPYLVEREC* |
| Ga0181473_1123001 | 3300013866 | Clean Room | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVADNPYLVEREC |
| Ga0181469_1026193 | 3300013868 | Clean Room | MLLSYIPMEDQDADILTKALTRRKFEYHRGRIGVDDNPYLVEREC* |
| Ga0181469_1040664 | 3300013868 | Clean Room | MLLSYIPTEDQDADILMKVLTRSKFEYHQARIGVADNPYLIEREC* |
| Ga0181469_1049261 | 3300013868 | Clean Room | MEDQDADILTKALTRRKFEYHRGRIGVADNPYLIEREC* |
| Ga0181469_1053795 | 3300013868 | Clean Room | MLLSHIPTEDQDGDILMKALTRRKFEYHRGKIGVDDNPYLFEREC* |
| Ga0181469_1089822 | 3300013868 | Clean Room | MLLSYLPTKDQDADILMKALTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0181469_1153852 | 3300013868 | Clean Room | MLLSYIPMEDQDADILVKALTRRKFEYHRGKIGVADNPYLVKREC* |
| Ga0181468_1012262 | 3300013869 | Clean Room | MLLSYIPTEDQDADILMKALTKRKFEYHRGRIGVANNPYIVEREC* |
| Ga0181468_1016052 | 3300013869 | Clean Room | MLLSYIPTEDQDADILMKALTRSKFEYHRGRIGVVDNPYLIEREC* |
| Ga0181465_1028288 | 3300013870 | Clean Room | MLLSYIPMEDQDVDILTKALTRSKFEYHQGRIGVADNPYLVEREC* |
| Ga0181465_1266581 | 3300013870 | Clean Room | MLLSYIPTEDQDADILTKVLTRRKFEYHRGRIGVDDNPYLV |
| Ga0181463_100005413 | 3300013872 | Clean Room | MLLSYISTEDQDADILTKALTRRKFEYHQGRIGVANNPSLVEREC* |
| Ga0181463_10034534 | 3300013872 | Clean Room | MLLSYILTEDQDADILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0181463_10174663 | 3300013872 | Clean Room | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVVDN |
| Ga0181464_100006922 | 3300013873 | Clean Room | MLLSYVPTEDQDVDILTKVLTRSKFEYHRGRIRVADNPYLVEREC* |
| Ga0181464_10017355 | 3300013873 | Clean Room | MLLSYIPTKDQDVDILTKALTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0181464_10040894 | 3300013873 | Clean Room | MLLSYIPTEDQDADILMKALTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0181464_10102483 | 3300013873 | Clean Room | MLLSYIPTKDQDADILMKVLTRSKFEYHRGRIGVADNPYLVEREC* |
| Ga0181464_10226462 | 3300013873 | Clean Room | MLLSYIPTEDQDANILTKALTRSKFEYHQGRIGVADN |
| Ga0181464_10271931 | 3300013873 | Clean Room | MLLSYFPTEDQDVDILMKALTRSKLEYHRGRIGVADNPYLFEREC* |
| Ga0181464_10627721 | 3300013873 | Clean Room | MLLSYIPTEDQDADILMKALTRRKFEYHRGKIGVADNPYLVKREC* |
| Ga0181464_10653781 | 3300013873 | Clean Room | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVADNTYLVERSVENATR* |
| Ga0182128_10232891 | 3300015277 | Miscanthus Phyllosphere | LQYIPTEDQDADILMKALTRNKFEYHRGRIGVNDPDLCRNATE* |
| Ga0182128_10286321 | 3300015277 | Miscanthus Phyllosphere | IRDCVQRKIMLLSYIPTEDQDADILMKALTKRKFEYHRGRIGVSDNPYLVEREC* |
| Ga0182125_10246971 | 3300015291 | Miscanthus Phyllosphere | DRDVDILTKVLTKSKFEYHKGRIRVEDNPYLVEREC* |
| Ga0182125_10588902 | 3300015291 | Miscanthus Phyllosphere | TEDQDVDILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0182126_10035681 | 3300015294 | Miscanthus Phyllosphere | MMLSYVPTEDQDADILTKALTRSKFEFHRGRIGIADNPYLAEREC* |
| Ga0182123_10618051 | 3300015303 | Miscanthus Phyllosphere | MLLSYIPTEDQDADILTKVLTRRKFEFHRGRIWVADNPYLVEREC* |
| Ga0182144_10612371 | 3300015307 | Miscanthus Phyllosphere | MLLQYIPIEDQDADIQTKALTRRKFEYHRGRIGVKDNPYLVEREC* |
| Ga0182120_11239221 | 3300015315 | Switchgrass Phyllosphere | MMRSYVPTEDQDADILTKALTRSKFEFHRGRIGVADNPYLAKREC* |
| Ga0182127_10105411 | 3300015321 | Miscanthus Phyllosphere | YVPTEDQDADILTKALTRSKFEFHRGRIGIADNPYLAEREC* |
| Ga0182134_10519661 | 3300015324 | Switchgrass Phyllosphere | MLLSYIPTEDQDANILTKALTRRKFEYHRGRIGVADNPYLVEREC* |
| Ga0182117_10146222 | 3300015332 | Switchgrass Phyllosphere | MLLSYVPTEDQDDDILTKALTRSKFEFHRGRIVVADNPYLAEREF* |
| Ga0182117_10304691 | 3300015332 | Switchgrass Phyllosphere | IPTEDQDANILTKALTRRKFKYHRGRIGVADNPYLVEREC* |
| Ga0182133_10708431 | 3300015340 | Switchgrass Phyllosphere | MEDQDADISTKALTRRKFEYHRGRIRVADNPHLVEREC* |
| Ga0182145_10045231 | 3300015361 | Miscanthus Phyllosphere | VQRRIMMLSYVPTEDQDADILTKALTRSKFEFHRGRIGIADNPYLAEREC* |
| Ga0182145_11084202 | 3300015361 | Miscanthus Phyllosphere | MLLSYIPTEDQDADILMKALTKSKFEYHRGRIGVADNPYLVEREC* |
| Ga0190268_114356541 | 3300018466 | Soil | RDCVQRKIILLSYIPTEDQDADILTKALTKSKFKYHRGRIGVADNPYLVEREC |
| Ga0213497_10031112 | 3300020586 | Leaf | YIPTEDQDADILTKALTRSKFEYHRGKIGVVDNPYLIEREC |
| Ga0213495_100177451 | 3300020588 | Leaf | MLLSYIPMEDQDADILTKALTRSKFEYHRGRIGVADNPYLVEREC |
| Ga0213496_100897371 | 3300020590 | Leaf | MLLSYIPTEDHDVDILTKALTRSKFEYHRDRIGVADNPYLVEREC |
| Ga0213498_100337102 | 3300020600 | Leaf | MLLSYNPTEDQDVDILTKALTRSKFEYHRGRIGVADNPYLVEREC |
| Ga0214090_104718552 | 3300020816 | Food Waste | MLLQYIPTEDQDADILTKALTKRKFEYHRDRIRVKDNPFLVEREC |
| Ga0214090_108580601 | 3300020816 | Food Waste | MLLSYIPMEDQDADILTKALTRSKFEYHRGRIGVVDNPYLVEREC |
| Ga0214090_108752041 | 3300020816 | Food Waste | MLSYVPTEDQDADILTKALTRSKFEFHRGRIGVADNPYLAEREC |
| Ga0214090_109106791 | 3300020816 | Food Waste | MEDQDENILMKVLTRRKLEYHRGRIRVADNPFIVEREC |
| Ga0214258_104486922 | 3300020817 | Food Waste | MEDQDADILMKALTKRKYEYNRDRIGVKDNPFLVEREC |
| Ga0214258_111235261 | 3300020817 | Food Waste | CVQWRIMMLSYVPTEDQDVDILTKALTRSKFEFHRGRIGVENNPYLAEREC |
| Ga0224566_1068582 | 3300022728 | Plant Litter | MLLQYIPTEDQDADILMKPLTRSKFEYHRDRIGVKDNPFLVERE |
| Ga0255813_100911651 | 3300023280 | Food Waste | MLLPYIPAEDQDAYILTKELTRIEFKYHRGRIRVKDNPYIVEREC |
| Ga0255813_109651201 | 3300023280 | Food Waste | MLLQYIPTEDQDADILTKALTKRKLEYHRDMIGVKDNPFLVEREC |
| Ga0255813_109811982 | 3300023280 | Food Waste | MLLQYIPTEDEDADILTKELAKRKFEYHKSRIGVADIPFLVEREC |
| Ga0255813_111691671 | 3300023280 | Food Waste | TEDQDADILTKALTRSKFEFHRGRIGVADNPYLAEREC |
| Ga0256703_103841671 | 3300023291 | Food Waste | MLSYVPTEDQDADILTKALTRSKFEFHRGRIRVADNPYLAEREC |
| Ga0256703_105958601 | 3300023291 | Food Waste | MLLQYIYTEDQNADILMKVLGTRKFKYHRGRIGVKDNPYLVEREC |
| Ga0256703_107441582 | 3300023291 | Food Waste | MLLSYIPTEDQDADILTKALTRRKFEYHRGRIEVEDNPYLVEREY |
| Ga0256703_107569961 | 3300023291 | Food Waste | MLLQYIPTEDQDADILMKALTRSKFKYHRGRIGVADNPYLVERKC |
| Ga0256703_107650951 | 3300023291 | Food Waste | MLPQYIPTEDQDENILTKVLTRRKFEYHRGRIEVKDNPYLVEREC |
| Ga0256702_111765701 | 3300023300 | Food Waste | MLLSYIPTEDQDADILTKALTRSKFEYHRGRIGVADNPYLFEREC |
| Ga0256702_113164321 | 3300023300 | Food Waste | MLLQYILMEDQDADILTKALTRIKFEYHRDRIGAADNPYLLEREC |
| Ga0256702_115790592 | 3300023300 | Food Waste | MLLSYIPTEDQDADILTKALTRRKFEYHRGMIGVVDNPYLVEREC |
| Ga0256702_116502951 | 3300023300 | Food Waste | MEDQDVDILTKALTRKKIEYHRDNIRVKDNPFLVEREF |
| Ga0256702_122557481 | 3300023300 | Food Waste | VQQKIMFLQYIPTKDRDVDILTKALSRRKFEYHRGKIGVKDNPYL |
| Ga0256702_122806022 | 3300023300 | Food Waste | MLLQYIPTEDQDADILTKAFTKRKFKYHRGRIRVPDNPFLVEREC |
| Ga0256702_124344552 | 3300023300 | Food Waste | EDQDADTLTKVLTRRKFECHRDKIGVKDNPFLVERECLDSTR |
| Ga0256702_127193381 | 3300023300 | Food Waste | MEDQDANILMKVLTRRKFEYHRDKIGVKDNPFPFERECLDSTRRS |
| Ga0209007_10161532 | 3300027652 | Forest Soil | MLLSYIPTEDQDADILTKALTRSKFEYHLGRIGVADNPYLVEREC |
| Ga0268246_102031161 | 3300030495 | Agave | MLLQLIPTEDRDADILTKAVTKRKFEYHRGMIRVADNPFLVEREC |
| Ga0307421_11358661 | 3300031355 | Salt Marsh | QRRIMMLSYVPTEDQDADILTKALTRSKFEFHRGRIGIADNPYLAEREC |
| Ga0310686_1021135602 | 3300031708 | Soil | MEYQDANILTKAVTRRKYEYHRDRIEVKDTPLLVEREH |
| Ga0310686_1070840351 | 3300031708 | Soil | TEDQDADILTKVLTMRKFEYHRDKIGVKDNPFLVEREC |
| Ga0310686_1117506621 | 3300031708 | Soil | MEDQDVDILMKALTWRKFKYHRDRIGVKDNPFLVERE |
| Ga0310686_1119833421 | 3300031708 | Soil | LQYIPTEDQDVDILMKALTRRIFKYHRDRIEVKDNPFLVEREC |
| Ga0321339_11293502 | 3300032551 | Switchgrass Phyllosphere | MLLQYIPTEDHNADILMKALTRSKFEYHRGRIGVKDNPYLVE |
| Ga0214484_10886731 | 3300032591 | Switchgrass Phyllosphere | MLLSYIPMEDQDADILTKALTRSKFEYHRGRIGAADNPYL |
| Ga0214484_11047122 | 3300032591 | Switchgrass Phyllosphere | QRIMLLSYIPTEDQDADILTKALTRRKFEYHRGRIGVADNPYLFEREC |
| Ga0214485_10842851 | 3300032698 | Switchgrass Phyllosphere | QDADVLTKALAKSKFEYHRGRIGVADNPFLVEREC |
| Ga0316214_10001431 | 3300033545 | Roots | DQDAHILMKPLTRRKFEYHRDRIGVKDNPFLVEREC |
| ⦗Top⦘ |