| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010963 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121592 | Gp0156615 | Ga0138108 |
| Sample Name | Subsoil microbial communities from Rio Tinto Huelva, Spain - T211 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Autonomous University of Barcelona |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18640120 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsoil Microbial Communities From Rio Tinto Huelva, Spain |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil → Subsoil Microbial Communities From Rio Tinto Huelva, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Huelva, Spain | |||||||
| Coordinates | Lat. (o) | 37.26 | Long. (o) | -6.94 | Alt. (m) | N/A | Depth (m) | 250 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021823 | Metagenome / Metatranscriptome | 217 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0138108_100254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 12388 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0138108_100254 | Ga0138108_1002545 | F021823 | MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |