


| Basic Information | |
|---|---|
| Family ID | F021823 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 217 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 217 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.44 % |
| % of genes near scaffold ends (potentially truncated) | 26.73 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.263 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.982 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.493 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.369 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 217 Family Scaffolds |
|---|---|---|
| PF03989 | DNA_gyraseA_C | 12.44 |
| PF04377 | ATE_C | 6.45 |
| PF03401 | TctC | 3.69 |
| PF04392 | ABC_sub_bind | 2.30 |
| PF03692 | CxxCxxCC | 1.84 |
| PF10129 | OpgC_C | 1.38 |
| PF04191 | PEMT | 1.38 |
| PF00072 | Response_reg | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF06271 | RDD | 0.92 |
| PF05014 | Nuc_deoxyrib_tr | 0.92 |
| PF00330 | Aconitase | 0.92 |
| PF12681 | Glyoxalase_2 | 0.92 |
| PF00694 | Aconitase_C | 0.92 |
| PF04355 | SmpA_OmlA | 0.92 |
| PF13191 | AAA_16 | 0.46 |
| PF04199 | Cyclase | 0.46 |
| PF03797 | Autotransporter | 0.46 |
| PF13489 | Methyltransf_23 | 0.46 |
| PF13439 | Glyco_transf_4 | 0.46 |
| PF02754 | CCG | 0.46 |
| PF08545 | ACP_syn_III | 0.46 |
| PF01522 | Polysacc_deac_1 | 0.46 |
| PF01656 | CbiA | 0.46 |
| PF13180 | PDZ_2 | 0.46 |
| PF02615 | Ldh_2 | 0.46 |
| PF02371 | Transposase_20 | 0.46 |
| PF08309 | LVIVD | 0.46 |
| PF01566 | Nramp | 0.46 |
| PF03069 | FmdA_AmdA | 0.46 |
| PF01850 | PIN | 0.46 |
| PF08031 | BBE | 0.46 |
| PF02445 | NadA | 0.46 |
| PF01272 | GreA_GreB | 0.46 |
| PF02776 | TPP_enzyme_N | 0.46 |
| PF00239 | Resolvase | 0.46 |
| PF01381 | HTH_3 | 0.46 |
| PF00701 | DHDPS | 0.46 |
| PF00210 | Ferritin | 0.46 |
| PF01799 | Fer2_2 | 0.46 |
| PF13242 | Hydrolase_like | 0.46 |
| PF13188 | PAS_8 | 0.46 |
| PF13557 | Phenol_MetA_deg | 0.46 |
| PF02254 | TrkA_N | 0.46 |
| PF13924 | Lipocalin_5 | 0.46 |
| PF01425 | Amidase | 0.46 |
| PF00490 | ALAD | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 12.44 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 6.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.69 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.30 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.92 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.92 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.46 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.46 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.46 |
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 0.46 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.46 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.46 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.46 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.46 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.46 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.46 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.46 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.46 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.46 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.26 % |
| Unclassified | root | N/A | 20.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13872126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 698 | Open in IMG/M |
| 3300001471|JGI12712J15308_10040512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1192 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101362115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 602 | Open in IMG/M |
| 3300004082|Ga0062384_100447805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 843 | Open in IMG/M |
| 3300005332|Ga0066388_100049876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni | 4282 | Open in IMG/M |
| 3300005332|Ga0066388_100961206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1424 | Open in IMG/M |
| 3300005332|Ga0066388_104733570 | Not Available | 692 | Open in IMG/M |
| 3300005436|Ga0070713_101663514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 620 | Open in IMG/M |
| 3300005531|Ga0070738_10000840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 76109 | Open in IMG/M |
| 3300005542|Ga0070732_10326982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300005559|Ga0066700_10662823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005586|Ga0066691_10528614 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005614|Ga0068856_100659272 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300005617|Ga0068859_100342938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1588 | Open in IMG/M |
| 3300005713|Ga0066905_100096928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1991 | Open in IMG/M |
| 3300005713|Ga0066905_101076355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 713 | Open in IMG/M |
| 3300005764|Ga0066903_100105159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3837 | Open in IMG/M |
| 3300005764|Ga0066903_100145994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3382 | Open in IMG/M |
| 3300005764|Ga0066903_100206957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2947 | Open in IMG/M |
| 3300005764|Ga0066903_100221512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2869 | Open in IMG/M |
| 3300005764|Ga0066903_100231687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2818 | Open in IMG/M |
| 3300005764|Ga0066903_100233111 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300005764|Ga0066903_100518267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2028 | Open in IMG/M |
| 3300005764|Ga0066903_101534857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300005764|Ga0066903_102056112 | Not Available | 1098 | Open in IMG/M |
| 3300005764|Ga0066903_102706085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 962 | Open in IMG/M |
| 3300005764|Ga0066903_103531902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300005764|Ga0066903_104274046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 764 | Open in IMG/M |
| 3300005764|Ga0066903_104766976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005764|Ga0066903_105184550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 690 | Open in IMG/M |
| 3300005764|Ga0066903_105510930 | Not Available | 667 | Open in IMG/M |
| 3300005764|Ga0066903_107780570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 551 | Open in IMG/M |
| 3300005764|Ga0066903_108073708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 539 | Open in IMG/M |
| 3300005921|Ga0070766_10794400 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005937|Ga0081455_10475892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 846 | Open in IMG/M |
| 3300005983|Ga0081540_1000474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 39520 | Open in IMG/M |
| 3300005985|Ga0081539_10059397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2105 | Open in IMG/M |
| 3300006028|Ga0070717_10364007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
| 3300006174|Ga0075014_100821975 | Not Available | 550 | Open in IMG/M |
| 3300006175|Ga0070712_100068916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2522 | Open in IMG/M |
| 3300006175|Ga0070712_100129651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1909 | Open in IMG/M |
| 3300006175|Ga0070712_102009138 | Not Available | 506 | Open in IMG/M |
| 3300006176|Ga0070765_100089471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2634 | Open in IMG/M |
| 3300006178|Ga0075367_10090533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1861 | Open in IMG/M |
| 3300006186|Ga0075369_10002471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6597 | Open in IMG/M |
| 3300006186|Ga0075369_10505149 | Not Available | 575 | Open in IMG/M |
| 3300006195|Ga0075366_10847816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 569 | Open in IMG/M |
| 3300006806|Ga0079220_10287857 | Not Available | 1007 | Open in IMG/M |
| 3300006852|Ga0075433_10985701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 734 | Open in IMG/M |
| 3300006893|Ga0073928_10161931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 1793 | Open in IMG/M |
| 3300009038|Ga0099829_10372669 | Not Available | 1178 | Open in IMG/M |
| 3300009176|Ga0105242_10482912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1175 | Open in IMG/M |
| 3300009525|Ga0116220_10236407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300009792|Ga0126374_10660891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum | 780 | Open in IMG/M |
| 3300009820|Ga0105085_1020807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300009826|Ga0123355_10235521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2605 | Open in IMG/M |
| 3300009826|Ga0123355_11732312 | Not Available | 593 | Open in IMG/M |
| 3300009840|Ga0126313_11613843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300010046|Ga0126384_11806504 | Not Available | 580 | Open in IMG/M |
| 3300010047|Ga0126382_10592233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 911 | Open in IMG/M |
| 3300010048|Ga0126373_10275479 | Not Available | 1667 | Open in IMG/M |
| 3300010048|Ga0126373_11161831 | Not Available | 838 | Open in IMG/M |
| 3300010154|Ga0127503_10848322 | Not Available | 607 | Open in IMG/M |
| 3300010343|Ga0074044_10189571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1368 | Open in IMG/M |
| 3300010343|Ga0074044_10772781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 627 | Open in IMG/M |
| 3300010358|Ga0126370_10285664 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300010358|Ga0126370_10938628 | Not Available | 784 | Open in IMG/M |
| 3300010358|Ga0126370_11609082 | Not Available | 622 | Open in IMG/M |
| 3300010360|Ga0126372_10487855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1153 | Open in IMG/M |
| 3300010360|Ga0126372_10728412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum | 972 | Open in IMG/M |
| 3300010360|Ga0126372_12138085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 608 | Open in IMG/M |
| 3300010360|Ga0126372_12463256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300010360|Ga0126372_13242132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 506 | Open in IMG/M |
| 3300010361|Ga0126378_10358614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1568 | Open in IMG/M |
| 3300010376|Ga0126381_102649607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 717 | Open in IMG/M |
| 3300010379|Ga0136449_100458206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2234 | Open in IMG/M |
| 3300010379|Ga0136449_101222834 | Not Available | 1180 | Open in IMG/M |
| 3300010400|Ga0134122_10663096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 974 | Open in IMG/M |
| 3300010963|Ga0138108_100254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 12388 | Open in IMG/M |
| 3300011270|Ga0137391_10022289 | All Organisms → cellular organisms → Bacteria | 5235 | Open in IMG/M |
| 3300012088|Ga0153944_1033265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300012096|Ga0137389_11132989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300012189|Ga0137388_11427308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300012212|Ga0150985_110375346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 628 | Open in IMG/M |
| 3300012212|Ga0150985_118884085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1272 | Open in IMG/M |
| 3300012362|Ga0137361_10843643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus | 832 | Open in IMG/M |
| 3300012469|Ga0150984_101552587 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012469|Ga0150984_112940970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1035 | Open in IMG/M |
| 3300012925|Ga0137419_11693884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 539 | Open in IMG/M |
| 3300012955|Ga0164298_10912955 | Not Available | 640 | Open in IMG/M |
| 3300012957|Ga0164303_10924840 | Not Available | 613 | Open in IMG/M |
| 3300012964|Ga0153916_12809777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 549 | Open in IMG/M |
| 3300012971|Ga0126369_11079489 | Not Available | 892 | Open in IMG/M |
| 3300014165|Ga0181523_10327525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 861 | Open in IMG/M |
| 3300014168|Ga0181534_10497992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300014489|Ga0182018_10447171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 687 | Open in IMG/M |
| 3300014493|Ga0182016_10242897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300014501|Ga0182024_11838677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 676 | Open in IMG/M |
| 3300015242|Ga0137412_10198068 | Not Available | 1605 | Open in IMG/M |
| 3300016270|Ga0182036_11094146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300016294|Ga0182041_10479969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1074 | Open in IMG/M |
| 3300016294|Ga0182041_11634208 | Not Available | 595 | Open in IMG/M |
| 3300016319|Ga0182033_10170702 | Not Available | 1701 | Open in IMG/M |
| 3300016319|Ga0182033_10529651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300016422|Ga0182039_11335504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300016445|Ga0182038_11350395 | Not Available | 638 | Open in IMG/M |
| 3300017932|Ga0187814_10436832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 512 | Open in IMG/M |
| 3300017942|Ga0187808_10245420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300017943|Ga0187819_10123387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1546 | Open in IMG/M |
| 3300017947|Ga0187785_10296312 | Not Available | 742 | Open in IMG/M |
| 3300017955|Ga0187817_11077359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300017970|Ga0187783_10345090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1084 | Open in IMG/M |
| 3300017970|Ga0187783_10474455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 907 | Open in IMG/M |
| 3300017972|Ga0187781_10071923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 2384 | Open in IMG/M |
| 3300017973|Ga0187780_11298826 | Not Available | 535 | Open in IMG/M |
| 3300017974|Ga0187777_11041063 | Not Available | 593 | Open in IMG/M |
| 3300017975|Ga0187782_10447697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300017975|Ga0187782_10850100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 707 | Open in IMG/M |
| 3300018032|Ga0187788_10267450 | Not Available | 683 | Open in IMG/M |
| 3300018034|Ga0187863_10894105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 504 | Open in IMG/M |
| 3300018062|Ga0187784_10513507 | Not Available | 965 | Open in IMG/M |
| 3300018062|Ga0187784_11220322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 596 | Open in IMG/M |
| 3300018433|Ga0066667_11317890 | Not Available | 631 | Open in IMG/M |
| 3300018466|Ga0190268_10214508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300018481|Ga0190271_12871664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 578 | Open in IMG/M |
| 3300019238|Ga0180112_1228210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300019248|Ga0180117_1222374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300020593|Ga0180221_1015972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2505 | Open in IMG/M |
| 3300021086|Ga0179596_10051620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1709 | Open in IMG/M |
| 3300021168|Ga0210406_10608608 | Not Available | 852 | Open in IMG/M |
| 3300021170|Ga0210400_10801101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300021180|Ga0210396_11021307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 699 | Open in IMG/M |
| 3300021401|Ga0210393_11352212 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021402|Ga0210385_10325514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1144 | Open in IMG/M |
| 3300021403|Ga0210397_10199387 | Not Available | 1430 | Open in IMG/M |
| 3300021441|Ga0213871_10021362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1613 | Open in IMG/M |
| 3300021475|Ga0210392_11405041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 522 | Open in IMG/M |
| 3300021478|Ga0210402_11115166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 716 | Open in IMG/M |
| 3300021560|Ga0126371_10003773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13310 | Open in IMG/M |
| 3300021560|Ga0126371_10236057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300021560|Ga0126371_10488211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1379 | Open in IMG/M |
| 3300021560|Ga0126371_10602295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1248 | Open in IMG/M |
| 3300021560|Ga0126371_10777570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1104 | Open in IMG/M |
| 3300021560|Ga0126371_12808211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
| 3300021560|Ga0126371_13386765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 538 | Open in IMG/M |
| 3300021560|Ga0126371_13440459 | Not Available | 534 | Open in IMG/M |
| 3300022530|Ga0242658_1206285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300025915|Ga0207693_10086586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2455 | Open in IMG/M |
| 3300025915|Ga0207693_10527253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300025915|Ga0207693_11355942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 530 | Open in IMG/M |
| 3300025928|Ga0207700_11183739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 682 | Open in IMG/M |
| 3300025928|Ga0207700_11790348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300025931|Ga0207644_10464585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1041 | Open in IMG/M |
| 3300025934|Ga0207686_10145320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1644 | Open in IMG/M |
| 3300026490|Ga0257153_1043050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300026551|Ga0209648_10057458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3310 | Open in IMG/M |
| 3300027030|Ga0208240_1031840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 587 | Open in IMG/M |
| 3300027648|Ga0209420_1127249 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300027706|Ga0209581_1268066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 519 | Open in IMG/M |
| 3300027846|Ga0209180_10250111 | Not Available | 1020 | Open in IMG/M |
| 3300027875|Ga0209283_10550389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300027903|Ga0209488_10216511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Hartmannibacter → Hartmannibacter diazotrophicus | 1442 | Open in IMG/M |
| 3300027905|Ga0209415_10932708 | Not Available | 586 | Open in IMG/M |
| 3300027908|Ga0209006_10009147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8942 | Open in IMG/M |
| 3300027908|Ga0209006_10841135 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027952|Ga0209889_1027314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1261 | Open in IMG/M |
| 3300028792|Ga0307504_10328095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300028877|Ga0302235_10293095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300029701|Ga0222748_1018055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300029943|Ga0311340_10019658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8476 | Open in IMG/M |
| 3300030020|Ga0311344_11134326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300031231|Ga0170824_108961832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300031238|Ga0265332_10001922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10999 | Open in IMG/M |
| 3300031545|Ga0318541_10631156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 599 | Open in IMG/M |
| 3300031561|Ga0318528_10757839 | Not Available | 519 | Open in IMG/M |
| 3300031573|Ga0310915_10668787 | Not Available | 734 | Open in IMG/M |
| 3300031708|Ga0310686_113060733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300031708|Ga0310686_115115834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 610 | Open in IMG/M |
| 3300031724|Ga0318500_10283676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300031728|Ga0316578_10027792 | Not Available | 3199 | Open in IMG/M |
| 3300031744|Ga0306918_10848394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 713 | Open in IMG/M |
| 3300031797|Ga0318550_10193556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300031833|Ga0310917_10235720 | Not Available | 1230 | Open in IMG/M |
| 3300031833|Ga0310917_10896333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 597 | Open in IMG/M |
| 3300031846|Ga0318512_10314473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 780 | Open in IMG/M |
| 3300031890|Ga0306925_10111774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2916 | Open in IMG/M |
| 3300031890|Ga0306925_11376675 | Not Available | 697 | Open in IMG/M |
| 3300031890|Ga0306925_11842703 | Not Available | 578 | Open in IMG/M |
| 3300031912|Ga0306921_12213701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031918|Ga0311367_11567447 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031941|Ga0310912_10977608 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031941|Ga0310912_11160275 | Not Available | 589 | Open in IMG/M |
| 3300031942|Ga0310916_10326520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1302 | Open in IMG/M |
| 3300031942|Ga0310916_10381454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1199 | Open in IMG/M |
| 3300031947|Ga0310909_11268092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 594 | Open in IMG/M |
| 3300031954|Ga0306926_11194025 | Not Available | 894 | Open in IMG/M |
| 3300031954|Ga0306926_11938509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 664 | Open in IMG/M |
| 3300031954|Ga0306926_12894429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 516 | Open in IMG/M |
| 3300032001|Ga0306922_11010285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 858 | Open in IMG/M |
| 3300032041|Ga0318549_10181865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300032160|Ga0311301_10929890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1165 | Open in IMG/M |
| 3300032160|Ga0311301_11980778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 681 | Open in IMG/M |
| 3300032180|Ga0307471_103519278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 554 | Open in IMG/M |
| 3300032205|Ga0307472_100038612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2858 | Open in IMG/M |
| 3300032261|Ga0306920_100078113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4865 | Open in IMG/M |
| 3300032261|Ga0306920_100657944 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300032261|Ga0306920_102612953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 692 | Open in IMG/M |
| 3300032261|Ga0306920_102643770 | Not Available | 687 | Open in IMG/M |
| 3300032515|Ga0348332_12208845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300032515|Ga0348332_14272826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300032892|Ga0335081_10001144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 42323 | Open in IMG/M |
| 3300032892|Ga0335081_10942490 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300032893|Ga0335069_10879871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300032893|Ga0335069_10949423 | Not Available | 958 | Open in IMG/M |
| 3300032896|Ga0335075_10949223 | Not Available | 780 | Open in IMG/M |
| 3300033433|Ga0326726_10318019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300034384|Ga0372946_0085625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1463 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.84% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.92% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.92% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.46% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.46% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.46% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.46% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.46% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.46% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.46% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.46% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.46% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
| Subsoil | Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010963 | Subsoil microbial communities from Rio Tinto Huelva, Spain - T211 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012088 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ028 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020593 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_138721262 | 3300000363 | Soil | MITFLRRLAMHYGIYRRYPLAPLPALKNAWRISR* |
| JGI12712J15308_100405122 | 3300001471 | Forest Soil | MRAFTRRFLMHYGIYRRYPLRRLPALRNAWRTARA* |
| JGIcombinedJ26739_1013621152 | 3300002245 | Forest Soil | MNAFLRRLLMHYGIYRRYPLGRLPALRNAWRTAQP* |
| Ga0062384_1004478051 | 3300004082 | Bog Forest Soil | AENKMRAFIRRFLMHYGIYRRYPLGRFPALRNAWRVAQP* |
| Ga0066388_1000498766 | 3300005332 | Tropical Forest Soil | LNETLMVAFLRRFSLHYGIYRRYPLRPIKALKNAWRIARA* |
| Ga0066388_1009612062 | 3300005332 | Tropical Forest Soil | MMGVVMRAFVKRLLMHYGIYRRYPLPRLSALRNAWRNARA* |
| Ga0066388_1047335702 | 3300005332 | Tropical Forest Soil | MGMAMRAFIKRLLMHYGIYRRYPLPPLSAFRNAWRNARA* |
| Ga0070713_1016635141 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGKAMIAFLRRLLMHYGIYRRYPLARFSALRNAWRIARI* |
| Ga0070738_1000084046 | 3300005531 | Surface Soil | MGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0070732_103269822 | 3300005542 | Surface Soil | MRAFIRRFLMHYGIYRRYPLGRLPSLRNAWRNARA* |
| Ga0066700_106628232 | 3300005559 | Soil | MRAFIRRLLMHYGIYRRYPLRPFPALRNAWRIARV* |
| Ga0066691_105286141 | 3300005586 | Soil | MRAFIRRLLMHYGIYRRYPLRPLPALRNAWRIARV* |
| Ga0068856_1006592722 | 3300005614 | Corn Rhizosphere | MIAFIRRLSFHYEIYRGYPLSRFPALKNAWRIART* |
| Ga0068859_1003429382 | 3300005617 | Switchgrass Rhizosphere | VGFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR* |
| Ga0066905_1000969282 | 3300005713 | Tropical Forest Soil | MIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARV* |
| Ga0066905_1010763551 | 3300005713 | Tropical Forest Soil | RTMIAFIRRLFIHYDIYRRYPLARLPALRNAWRIARA* |
| Ga0066903_1001051592 | 3300005764 | Tropical Forest Soil | MITFLRRLFMHYGIYRRYPLAPLSALKNAWRIARA* |
| Ga0066903_1001459943 | 3300005764 | Tropical Forest Soil | MNTFVRRLLMHYGIYRRYPLAPLRALRNAWRIARA* |
| Ga0066903_1002069573 | 3300005764 | Tropical Forest Soil | MITFLRRFFMHYGIYRRYPLAPLSALKNAWRIARA* |
| Ga0066903_1002215127 | 3300005764 | Tropical Forest Soil | MVAFIRRLAMHYDIYRRYPLARLPALKNAWRIART* |
| Ga0066903_1002316873 | 3300005764 | Tropical Forest Soil | MHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP* |
| Ga0066903_1002331113 | 3300005764 | Tropical Forest Soil | MIAFIRRLLIHYDIYRRYPLARVPALKNAWRIARP* |
| Ga0066903_1005182673 | 3300005764 | Tropical Forest Soil | MAAFLRRFALHYGIYRRYPLRPFKALKNAWRIARD* |
| Ga0066903_1015348573 | 3300005764 | Tropical Forest Soil | MVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA* |
| Ga0066903_1020561122 | 3300005764 | Tropical Forest Soil | MVAFLRRFSLHYAIYRRYPLRPFKALKNAWRIARA* |
| Ga0066903_1027060851 | 3300005764 | Tropical Forest Soil | NCAGINMIAFMRRLSIHYDIYRSYPLARIPALKNAWRISRA* |
| Ga0066903_1035319023 | 3300005764 | Tropical Forest Soil | MRAFLKRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0066903_1042740461 | 3300005764 | Tropical Forest Soil | MRAFIRRFLMQYGIYRRYPLGRLPSLRNAWRNARA* |
| Ga0066903_1047669762 | 3300005764 | Tropical Forest Soil | MRAFLRRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0066903_1051845502 | 3300005764 | Tropical Forest Soil | MRAFIRRFFMHYGIYRRYPLGRLPSLRNAWRNARA* |
| Ga0066903_1055109301 | 3300005764 | Tropical Forest Soil | MISFCRRFRIHYDIYRRYPLSRVPALRNAWRIARA* |
| Ga0066903_1077805701 | 3300005764 | Tropical Forest Soil | MRAFIRRFLMHYGIYRRYPLRRLPSLRNAWRNARP* |
| Ga0066903_1080737082 | 3300005764 | Tropical Forest Soil | MRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0070766_107944003 | 3300005921 | Soil | MNAFLRRLLMHYGIYRRYPLGRLPALRTAQPKHSNS |
| Ga0081455_104758922 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIVFLRRLLFHYGVYRNYPLSPWPALKNAWRIVRI* |
| Ga0081540_10004744 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MITFIRRFLMHYGIYRRYPLAPLPALRNAWRIARA* |
| Ga0081539_100593972 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MIVFLRRLLFHYGVYRTYPLSPWPALKNAWRIVRI* |
| Ga0070717_103640072 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGFFRRLLMHYGIYRRYPLRPIPALASAWKIARP* |
| Ga0075014_1008219751 | 3300006174 | Watersheds | MRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA* |
| Ga0070712_1000689166 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP* |
| Ga0070712_1001296516 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRI* |
| Ga0070712_1020091382 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IMVAFLRRFSLHYGVYRRYPLRPIEALKNAWRIARA* |
| Ga0070765_1000894714 | 3300006176 | Soil | MRAFIRRFLMHYGIYRRYPLGRLPSLRNAWRNARV* |
| Ga0075367_100905332 | 3300006178 | Populus Endosphere | MHAFIRRFLLHYGINRRYHPLRRLTAARIAWRTARA* |
| Ga0075369_100024713 | 3300006186 | Populus Endosphere | MMYFFQRLFMHYGIYRRYPLAPLPALKSAWRISR* |
| Ga0075369_105051491 | 3300006186 | Populus Endosphere | MMSFFQRLFMHYGIYRRYPLAPVPAIKSAWRISR* |
| Ga0075366_108478161 | 3300006195 | Populus Endosphere | VGFNMISFVRRFVMHYGIYRRYPLAPMPAIKNAWRISR* |
| Ga0079220_102878571 | 3300006806 | Agricultural Soil | MLGFFRRLLMHYEIYRRYPLRPIPALASAWKIARP* |
| Ga0075433_109857013 | 3300006852 | Populus Rhizosphere | MIVFLRRLLFHYGVYRNYPLPPWPALKNAWRILRI* |
| Ga0073928_101619312 | 3300006893 | Iron-Sulfur Acid Spring | MRAFIRRLIMHYGIYRRYPLARLPALRNAWRNARA* |
| Ga0099829_103726692 | 3300009038 | Vadose Zone Soil | MRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0105242_104829122 | 3300009176 | Miscanthus Rhizosphere | FDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR* |
| Ga0116220_102364071 | 3300009525 | Peatlands Soil | HAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP* |
| Ga0126374_106608911 | 3300009792 | Tropical Forest Soil | HPRRVFAMLTFFRRLAMHYGIYRRYPLAPLAALKNAWRIARV* |
| Ga0105085_10208073 | 3300009820 | Groundwater Sand | MPGVRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA* |
| Ga0123355_102355212 | 3300009826 | Termite Gut | MRAFIRRFFLHYGINRRHPIDPLSAARDAWRIART* |
| Ga0123355_117323122 | 3300009826 | Termite Gut | MRAFIKRFFLHYGINRRHPVRRLSAVRDAWRIARA* |
| Ga0126313_116138432 | 3300009840 | Serpentine Soil | MNSFFRRFFMHYGIYRRYPLAHLPALKNAWRISR* |
| Ga0126384_118065041 | 3300010046 | Tropical Forest Soil | MRAFIRRFFLHYGINRRYPLRRLTAVRNAWRTARA* |
| Ga0126382_105922332 | 3300010047 | Tropical Forest Soil | MVMRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0126373_102754792 | 3300010048 | Tropical Forest Soil | MRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0126373_111618312 | 3300010048 | Tropical Forest Soil | MVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD* |
| Ga0127503_108483222 | 3300010154 | Soil | MIAFFRRLSMHYGIYRRYPLARLSALRNAWRIARA* |
| Ga0074044_101895712 | 3300010343 | Bog Forest Soil | MHAFLRRFLMHYGIYRRYPLGRLPALRNAWRTARP* |
| Ga0074044_107727812 | 3300010343 | Bog Forest Soil | MRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA* |
| Ga0126370_102856642 | 3300010358 | Tropical Forest Soil | MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRVART* |
| Ga0126370_109386282 | 3300010358 | Tropical Forest Soil | MRAFIRRFLLHYGINRRYPLRRLTAVRNAWRTARA* |
| Ga0126370_116090821 | 3300010358 | Tropical Forest Soil | PKTRRNRSGLNETLMVAFLRRFSLHYGIYRRYPLRPIKALKNAWRIARA* |
| Ga0126372_104878552 | 3300010360 | Tropical Forest Soil | MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRIART* |
| Ga0126372_107284121 | 3300010360 | Tropical Forest Soil | MITFFRRLFMHYGIYRRYPLAPLSALKNAWRIARA* |
| Ga0126372_121380852 | 3300010360 | Tropical Forest Soil | VGKAMIAFIRRLLMHYGIYRRYPLARFSALRNAWRIARI* |
| Ga0126372_124632562 | 3300010360 | Tropical Forest Soil | MAMRAFIKRLLMHYGIYRRYPLPPLSAFRNAWRNARA* |
| Ga0126372_132421321 | 3300010360 | Tropical Forest Soil | ETTGVAMRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0126378_103586141 | 3300010361 | Tropical Forest Soil | GLAMRAFVKRFLMHYGIYRRYPLGRLPSFRNAWRNARA* |
| Ga0126381_1026496072 | 3300010376 | Tropical Forest Soil | VGKAMIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI* |
| Ga0136449_1004582062 | 3300010379 | Peatlands Soil | MHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP* |
| Ga0136449_1012228342 | 3300010379 | Peatlands Soil | MASMRAFIRRFLMHYGIYRRYPLPRLSAMRNAWRNARA* |
| Ga0134122_106630962 | 3300010400 | Terrestrial Soil | VDFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR* |
| Ga0138108_1002545 | 3300010963 | Subsoil | MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA* |
| Ga0137391_100222892 | 3300011270 | Vadose Zone Soil | MLEFYRRLLLHYGIYRRYPLGLLPALKNAWRIART* |
| Ga0153944_10332651 | 3300012088 | Attine Ant Fungus Gardens | MRVFIRRFLMNYGIYRRYPLPRLSAMRNAWRNARA* |
| Ga0137389_111329892 | 3300012096 | Vadose Zone Soil | VAMRAFVRRFLMHYGIYRRYPLPRVSAFRNAWRNARA* |
| Ga0137388_114273082 | 3300012189 | Vadose Zone Soil | MGVAMRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA* |
| Ga0150985_1103753461 | 3300012212 | Avena Fatua Rhizosphere | MIAFIRRLSLHYDVYRSYPLPRVPALKNAWRIARA* |
| Ga0150985_1188840851 | 3300012212 | Avena Fatua Rhizosphere | QTVRVMVSFVRRLVMHYGIYRRYPLAPVPAIRNAWRISR* |
| Ga0137361_108436433 | 3300012362 | Vadose Zone Soil | GVAMRAFVRRFLMHYEIYRRYPLPRLSAVRNAWRNARA* |
| Ga0150984_1015525873 | 3300012469 | Avena Fatua Rhizosphere | QTVRIMVSFVRRLVMHYGIYRRYPLAPVPAIKNAWRISR* |
| Ga0150984_1129409701 | 3300012469 | Avena Fatua Rhizosphere | TMIAFIRRLSLHYDVYRSYPLPRVPALKNAWRIARA* |
| Ga0137419_116938842 | 3300012925 | Vadose Zone Soil | MAMRAFVRRFLMHYGIYRRYPLGRLPAFRNAWRNARA* |
| Ga0164298_109129551 | 3300012955 | Soil | MVAFLRRFSLHYGIYRRYPLTPFSALKNAWRIARA* |
| Ga0164303_109248401 | 3300012957 | Soil | MIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA* |
| Ga0153916_128097772 | 3300012964 | Freshwater Wetlands | MLPFIRRLLMHYDIYRRYPLRPLPALKNAWRISR* |
| Ga0126369_110794892 | 3300012971 | Tropical Forest Soil | MHAFLKRFLMHYGIYRRYPLGRLPTLRNAWRTARP* |
| Ga0181523_103275252 | 3300014165 | Bog | MRAFFRRLVMHYGIYRRYPLRRLSAFRNAWRNARA* |
| Ga0181534_104979922 | 3300014168 | Bog | MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA* |
| Ga0182018_104471711 | 3300014489 | Palsa | AFPESLSRRTKMHAFLRRFLMHYGVYRRYPLGLLPSLRNAWRIARA* |
| Ga0182016_102428971 | 3300014493 | Bog | MQSFVKRFMMHYGIYRRYPLGRLPALRNAWRTSRA* |
| Ga0182024_118386772 | 3300014501 | Permafrost | MNTFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA* |
| Ga0137412_101980682 | 3300015242 | Vadose Zone Soil | MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA* |
| Ga0182036_110941462 | 3300016270 | Soil | GETDMQAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP |
| Ga0182041_104799692 | 3300016294 | Soil | MLAFIKRFLMHYGIYRRYPLGRFPALRNAWRAAMS |
| Ga0182041_116342081 | 3300016294 | Soil | MIAFLRRLSMHYGIYRRYPLARLSALRNAWRIARA |
| Ga0182033_101707023 | 3300016319 | Soil | MRTFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA |
| Ga0182033_105296512 | 3300016319 | Soil | MRAFIKRFLMHYGVYRRYPLGRFPALRNAWRVAQP |
| Ga0182039_113355041 | 3300016422 | Soil | NRSGLNETLMVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA |
| Ga0182038_113503951 | 3300016445 | Soil | TTMIAFLRRLSMHYGIYRRYPLARLSALRNAWRIARA |
| Ga0187814_104368321 | 3300017932 | Freshwater Sediment | MMGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0187808_102454202 | 3300017942 | Freshwater Sediment | MMGLAMRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0187819_101233872 | 3300017943 | Freshwater Sediment | MASMRAFIRRFLMQYGIYRRYPLPRLSAMRNAWRNARA |
| Ga0187785_102963122 | 3300017947 | Tropical Peatland | MISFIRRFALHYGIYRRYPLGRIPALKNAWRMSRA |
| Ga0187817_110773591 | 3300017955 | Freshwater Sediment | MRAFIRRFLMQYGIYRRYPLPRLSAMRNAWRNARA |
| Ga0187783_103450902 | 3300017970 | Tropical Peatland | MRAFVKRLLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0187783_104744551 | 3300017970 | Tropical Peatland | MAVALAAAQDGNMRAFIRRFLMHYAIYRRYPLGRLPAMRNAWRNARA |
| Ga0187781_100719232 | 3300017972 | Tropical Peatland | MGADMRAFVRRFLMHYAIYRRYPLRRLPALRNAWRTARA |
| Ga0187780_112988262 | 3300017973 | Tropical Peatland | MFALPFLNRLWLHYSIYRGYPLRPAAALRNAWRIARR |
| Ga0187777_110410631 | 3300017974 | Tropical Peatland | MLALPFLNRLWLHYSIYRSYPLRPAAALRNAWRIARR |
| Ga0187782_104476972 | 3300017975 | Tropical Peatland | MRAFVRRFMMHYGIYRRYPLRRLPAIRNAWRTARA |
| Ga0187782_108501001 | 3300017975 | Tropical Peatland | MLHFWRRFLLHYGIYRRYPLGPLPALRNAWRIART |
| Ga0187788_102674501 | 3300018032 | Tropical Peatland | MIAFIRRFALHYGIYRRYPLRRIPALKNAWRMARA |
| Ga0187863_108941051 | 3300018034 | Peatland | LSRRTKMRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0187784_105135071 | 3300018062 | Tropical Peatland | MLQFLRRFLLHYGIYRRYPLGPLPALKNAWRIARA |
| Ga0187784_112203223 | 3300018062 | Tropical Peatland | MRAFFRRFVMHYGIYRRYPLRRLPALRNAWRTARA |
| Ga0066667_113178902 | 3300018433 | Grasslands Soil | MRAFIRRLLMHYGIYRRYPLRPLPALRNAWRIARV |
| Ga0190268_102145081 | 3300018466 | Soil | MVMPGLRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA |
| Ga0190271_128716642 | 3300018481 | Soil | MTMMTFLRRLAMHYSIYRRYPLAPLPALKNAWRISR |
| Ga0180112_12282101 | 3300019238 | Groundwater Sediment | AMRAFVRRFLMHYGIYRRYPLARIPAFRNAWRISRA |
| Ga0180117_12223742 | 3300019248 | Groundwater Sediment | KGTAMRAFVRRFLMHYGIYRRYPLARIPAFRNAWRISRA |
| Ga0180221_10159723 | 3300020593 | Compost | MVMLNFVRRLLMHYGIYRRYPLSRLPALKNAWRMAR |
| Ga0179596_100516202 | 3300021086 | Vadose Zone Soil | MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA |
| Ga0210406_106086082 | 3300021168 | Soil | EHAAGQTMIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA |
| Ga0210400_108011012 | 3300021170 | Soil | MRAFIRRLIMHYGIYRRYPLARLPALRNAWRNARA |
| Ga0210396_110213071 | 3300021180 | Soil | MRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0210393_113522121 | 3300021401 | Soil | MIAFIRRLSFHYEIYRGYPLSRFPALKNAWRIART |
| Ga0210385_103255141 | 3300021402 | Soil | FSRRTKMRAFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0210397_101993872 | 3300021403 | Soil | MRAFFRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0213871_100213622 | 3300021441 | Rhizosphere | MIAFIRRLLMHYGIYRRYPLARFPALRNAWRIARI |
| Ga0210392_114050411 | 3300021475 | Soil | ENLMRAFIKRFLMHYGIYRRYPFERFSALRNAWRVAQL |
| Ga0210402_111151661 | 3300021478 | Soil | MNAFLRRFLMHYGIYRRYPLGRLPALRNAWRIARPL |
| Ga0126371_1000377311 | 3300021560 | Tropical Forest Soil | MLGFLRRLLLHYAIYRRYPLRPLPALACAWKMARS |
| Ga0126371_102360571 | 3300021560 | Tropical Forest Soil | MSFLRRLLLHYAIYRRYPLRLRPLPALANAWKMARS |
| Ga0126371_104882112 | 3300021560 | Tropical Forest Soil | VGKAMIAFIRRLLMHYGIYRRYPLARFSALRNAWRIARI |
| Ga0126371_106022952 | 3300021560 | Tropical Forest Soil | MRAFVKRFLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0126371_107775702 | 3300021560 | Tropical Forest Soil | MLDFFRRLLLHYGIYRRYPLSPLPALKNAWRVART |
| Ga0126371_128082112 | 3300021560 | Tropical Forest Soil | MLALPFFNRLWLHYSVYRTYPLRPFAALRNAWRIARR |
| Ga0126371_133867651 | 3300021560 | Tropical Forest Soil | MHREQKKRAGTTMRAFVKRLLMHYGIYRRYPLPRISAFRNAWRNAR |
| Ga0126371_134404592 | 3300021560 | Tropical Forest Soil | MVAFLPRFSLHYAIYRRYPLRPFKALKGGSRIARA |
| Ga0242658_12062852 | 3300022530 | Soil | MRSFVRRFMMHYGIYRRYPLARLPAIRNAWRTARA |
| Ga0207693_100865867 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRA |
| Ga0207693_105272531 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRRTEMHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP |
| Ga0207693_113559421 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTFIRRFALHYDIYRRYPLARLPALKNAWRISRI |
| Ga0207700_111837392 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAFLRRLLMHYGIYRRYPLARFSALRNAWRIARI |
| Ga0207700_117903482 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LDRPRRTEMHAFLKRFLMHYGIYRRYPLGRLPALRNAWRTARP |
| Ga0207644_104645852 | 3300025931 | Switchgrass Rhizosphere | VGFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR |
| Ga0207686_101453202 | 3300025934 | Miscanthus Rhizosphere | VDFDMISFVRRFVMHYGIYRRYPLPPMPAIKNAWRISR |
| Ga0257153_10430501 | 3300026490 | Soil | MGVAMRAFVRRFLMHYEIYRRYPLPRLSAFRNAWRNAR |
| Ga0209648_100574582 | 3300026551 | Grasslands Soil | MRTFVRRFLMHYEIYRRYPLPRLSAFRNAWRNARA |
| Ga0208240_10318402 | 3300027030 | Forest Soil | MRAFLKRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0209420_11272492 | 3300027648 | Forest Soil | MRTFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0209581_12680661 | 3300027706 | Surface Soil | MGLAMRAFIKRFLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0209180_102501111 | 3300027846 | Vadose Zone Soil | MRAFVRRFLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0209283_105503891 | 3300027875 | Vadose Zone Soil | MRAFVRRFLMHYGIYRRYPLPRVSAFRNAWRNARA |
| Ga0209488_102165111 | 3300027903 | Vadose Zone Soil | EETIGVAMRAFVRRLLMHYGIYRRYPLPRLSAFRNAWRNARA |
| Ga0209415_109327081 | 3300027905 | Peatlands Soil | MLALPFLNRLWLHYSIYRSYPLTPTAALRNAWRIARR |
| Ga0209006_100091479 | 3300027908 | Forest Soil | MRAFTRRFLMHYGIYRRYPLRRLPALRNAWRTARA |
| Ga0209006_108411351 | 3300027908 | Forest Soil | MNTFLRRFLMHYEVYRRYPLGRLPALRNAWRTARP |
| Ga0209889_10273142 | 3300027952 | Groundwater Sand | MPGVRRTFIERLLFHYEVYRGYPLPRWSALKNAWRIARA |
| Ga0307504_103280952 | 3300028792 | Soil | MRAFVRRFLMHYGIYRRYPLAPLPALKNAWRISRA |
| Ga0302235_102930952 | 3300028877 | Palsa | RPRRTEMHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP |
| Ga0222748_10180552 | 3300029701 | Soil | GENKMHAFIRRFLMHYGIYRRYPLGRFPALRNAWRAAQP |
| Ga0311340_100196582 | 3300029943 | Palsa | MHAFIRRFLMHYGIYRRYPLGRLPALRNAWRTARP |
| Ga0311344_111343262 | 3300030020 | Bog | KMQSFVKRFMMHYGIYRRYPLGRLPALRNAWRTSRA |
| Ga0170824_1089618323 | 3300031231 | Forest Soil | MRAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP |
| Ga0265332_100019228 | 3300031238 | Rhizosphere | MLEFYRRFFLHYAIYRRYPLGPLPALKNAWRIART |
| Ga0318541_106311562 | 3300031545 | Soil | VGKAMIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI |
| Ga0318528_107578391 | 3300031561 | Soil | MCAFVRRFLMHYGIYRRYPLPRMSAFRNAWRNARA |
| Ga0310915_106687872 | 3300031573 | Soil | LNETLMVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD |
| Ga0310686_1130607332 | 3300031708 | Soil | MVAPMRAFVRRFLMHYGIYRRYPLRRMTAFRNAWRNARA |
| Ga0310686_1151158341 | 3300031708 | Soil | MATMRVFIRRFLMHYGIYRRYPLPRLSAMRNAWRIARA |
| Ga0318500_102836762 | 3300031724 | Soil | MRAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP |
| Ga0316578_100277921 | 3300031728 | Rhizosphere | VMRAFFKRFLMHYGIYRRYPLGRVPAIKNAWRISRA |
| Ga0306918_108483942 | 3300031744 | Soil | MIAFIRRLLMHYGIYRRYPLARLSALRNAWRIARI |
| Ga0318550_101935562 | 3300031797 | Soil | MHAFIKRFLMHYGVYRRYPLGRFPALRNAWRVAQP |
| Ga0310917_102357204 | 3300031833 | Soil | HLAWGNLMRAFIKRFLMYYGIYRRYPLRWFAALRNAWRVARS |
| Ga0310917_108963331 | 3300031833 | Soil | EDSPMRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA |
| Ga0318512_103144732 | 3300031846 | Soil | MRAFVKGFLMHYGIYRRYPLGRFPALRNAWRAAQL |
| Ga0306925_101117746 | 3300031890 | Soil | MRAFIKRFLMYYGIYRRYPLRWFAALRNAWRVARS |
| Ga0306925_113766751 | 3300031890 | Soil | MFAFIRRFSIHYNIYRGYPLARLPALKNAWRIARA |
| Ga0306925_118427031 | 3300031890 | Soil | MVAFLRRFSLHYGIYRRYLLRPFKALKNAWRIARD |
| Ga0306921_122137011 | 3300031912 | Soil | VAENKMLAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP |
| Ga0311367_115674473 | 3300031918 | Fen | MPSFLRRLFFHYGIYRRYPLRPLPALRNAWRIARP |
| Ga0310912_109776082 | 3300031941 | Soil | MQAFIRRFLMYYGIYRRYPLGRLPALRNAWRVTRDGSAA |
| Ga0310912_111602751 | 3300031941 | Soil | NKMRAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQL |
| Ga0310916_103265202 | 3300031942 | Soil | KMRAFIKRFLMHYGIYRRYPLGRFPALRNAWRVAQP |
| Ga0310916_103814543 | 3300031942 | Soil | MLAFIKRFLLHYGIYRRYPLGRFPALRNAWRAAQP |
| Ga0310909_112680922 | 3300031947 | Soil | MLAFIKRFLMHYGIYRRYPLGRFPALSNAWRAAQP |
| Ga0306926_111940251 | 3300031954 | Soil | GQTTMIAFLRRLSMHYGIYRRYPLARFSALRNAWRIARA |
| Ga0306926_119385092 | 3300031954 | Soil | LMRAFIKRFLMHYGIYRRYPLRWFAALRNAWRVARS |
| Ga0306926_128944292 | 3300031954 | Soil | IPFEDSPMRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA |
| Ga0306922_110102852 | 3300032001 | Soil | MRAFIKRFLMHYGIYRRYPLGRFPALRNAWHVAQP |
| Ga0318549_101818651 | 3300032041 | Soil | MRAFIKRFLMHYGIYRRYPLGRVPALRNAWRVAQP |
| Ga0311301_109298902 | 3300032160 | Peatlands Soil | MASMRAFIRRFLMHYGIYRRYPLPRLSAMRNAWRNARA |
| Ga0311301_119807781 | 3300032160 | Peatlands Soil | MRPFLRRFLMHYGIYRRYPLGLLPALRNAWRTARA |
| Ga0307471_1035192782 | 3300032180 | Hardwood Forest Soil | MITFLRRLFMHYGIYRRYPLAPLSALKNAWRIARV |
| Ga0307472_1000386122 | 3300032205 | Hardwood Forest Soil | MITFLRRFFMHYGIYRRYPLDPVSALKNAWRIARV |
| Ga0306920_1000781132 | 3300032261 | Soil | MRAFVRRFLMHYGIYRRYPLGRLPSLRNAWRNVRA |
| Ga0306920_1006579442 | 3300032261 | Soil | MRAFVRRFVMHYGIYRRYPLGRLPSLRNAWRNARA |
| Ga0306920_1026129531 | 3300032261 | Soil | LAENKMRTFIRRFLMHYGIYRRYPLGRFPALRNAWRVAQP |
| Ga0306920_1026437702 | 3300032261 | Soil | MVAFLPRFSLHYAIYRRYPLRPFKALKDASRIARA |
| Ga0348332_122088452 | 3300032515 | Plant Litter | MASMRAFIHRFLMHYGIYRRYPLPRLSAMRNAWRIARA |
| Ga0348332_142728262 | 3300032515 | Plant Litter | MRAFVQRFLMHYGIYRRYPLARLPALRNAWRTSRA |
| Ga0335081_1000114412 | 3300032892 | Soil | MTGFLRRLLLHYAIYRRYPLRPLPALANAWKMARS |
| Ga0335081_109424902 | 3300032892 | Soil | MIGFLRRLLLHYTIYRRYPLRPLPALANAWKMARS |
| Ga0335069_108798712 | 3300032893 | Soil | MRAFTRRFLMHYGIYRRYPLGRLPALRNAWRTARA |
| Ga0335069_109494231 | 3300032893 | Soil | MPSFVRRLIFHYGIYRRYPLRPLPALRNAWRIARA |
| Ga0335075_109492231 | 3300032896 | Soil | MLSGRNFIDRLLFHYDVYRSYPLSPWAALRNAWRIAR |
| Ga0326726_103180193 | 3300033433 | Peat Soil | SAEKDTEMRAFVRRFIMHYGIYRRYPLARIPAFRNAWRISRA |
| Ga0372946_0085625_956_1069 | 3300034384 | Soil | MLSRRSFIDRLVFHYDVYRRYPLPPWAALRNAWRIAR |
| ⦗Top⦘ |