NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009908

3300009908: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009908 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116874 | Gp0151161 | Ga0132233
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9826234
Sequencing Scaffolds4
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B171
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → meromictic pond → pond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000077Metagenome / Metatranscriptome2584Y
F000237Metagenome / Metatranscriptome1498Y
F025017Metagenome / Metatranscriptome203N
F046404Metagenome / Metatranscriptome151Y
F066528Metagenome / Metatranscriptome126Y
F103354Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0132233_101080Not Available812Open in IMG/M
Ga0132233_101510All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17721Open in IMG/M
Ga0132233_103671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
Ga0132233_104289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0132233_101080Ga0132233_1010801F066528PETMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0132233_101510Ga0132233_1015101F103354GAKKAVNESRSFASKAAGVAPKTQIVESNDFVKRMQKIAGII*
Ga0132233_101552Ga0132233_1015521F000237LFNKFYKTYYIIFTNKHLNTDQLTRLMVLHYFTP*YYLYLVKLHVMFCHES*DSDSGENVYEDKSGTYVS*FYDAFLKEIQDA*Y*TLYVFVYFIIHHFDASTVNYFFFER*NISELDEIRFYGVAPH*YFRPLMGLLVVSPSHYEGLM*MALWFVLLASLPIIYNFYNSSKYYLPIIPMQSSMSQTLCFILFMLSMYCTASMLPCGRYYYAPEGGYVGNP*VKFSYQYAYLYMA*IL
Ga0132233_103671Ga0132233_1036711F025017MASNMNISYRQGIRNKGFQVTVPTTGATQTLSLSGLAKAFEGIKFSSTTSAAP
Ga0132233_104068Ga0132233_1040681F000077TTHKDYSESVDALERAIVVLKKQSHNRKQASLVELSSLKGMNLIPASAKKTIDSFLAQDPEETPTGLDVTAPEAAGYEFQSHGVIDMLEKLHDKFIDERTTLEKEEMNSKHAYDMLMQDLTAQTDQATRDRGEKTEFKAAKLQAKADAEGSLSDTTTTRNSDQTYLDDLS
Ga0132233_104289Ga0132233_1042892F046404MNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLLIAAHIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.