


| Basic Information | |
|---|---|
| Family ID | F103354 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VNESKGFASKAAGVAPKKPIVESNDFVARMQKLAGII |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.03 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.426 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (11.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.693 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.554 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF07068 | Gp23 | 25.74 |
| PF02562 | PhoH | 1.98 |
| PF13692 | Glyco_trans_1_4 | 0.99 |
| PF04984 | Phage_sheath_1 | 0.99 |
| PF01391 | Collagen | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.98 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.98 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.43 % |
| All Organisms | root | All Organisms | 42.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001346|JGI20151J14362_10015417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4260 | Open in IMG/M |
| 3300003684|Ga0005851_1032652 | Not Available | 1714 | Open in IMG/M |
| 3300005527|Ga0068876_10304227 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 905 | Open in IMG/M |
| 3300006357|Ga0075502_1158596 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 629 | Open in IMG/M |
| 3300006390|Ga0075509_1525349 | All Organisms → Viruses → Predicted Viral | 1814 | Open in IMG/M |
| 3300006400|Ga0075503_1086677 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 624 | Open in IMG/M |
| 3300006425|Ga0075486_1048913 | Not Available | 1112 | Open in IMG/M |
| 3300006802|Ga0070749_10176200 | Not Available | 1233 | Open in IMG/M |
| 3300006919|Ga0070746_10262015 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 804 | Open in IMG/M |
| 3300007304|Ga0102689_1791798 | Not Available | 1309 | Open in IMG/M |
| 3300007538|Ga0099851_1093156 | Not Available | 1152 | Open in IMG/M |
| 3300007559|Ga0102828_1141113 | Not Available | 601 | Open in IMG/M |
| 3300007612|Ga0102801_1316849 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 536 | Open in IMG/M |
| 3300007706|Ga0102899_1201962 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 503 | Open in IMG/M |
| 3300007972|Ga0105745_1122755 | Not Available | 779 | Open in IMG/M |
| 3300008107|Ga0114340_1015485 | Not Available | 3654 | Open in IMG/M |
| 3300008107|Ga0114340_1065960 | Not Available | 1539 | Open in IMG/M |
| 3300008113|Ga0114346_1161340 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 944 | Open in IMG/M |
| 3300008116|Ga0114350_1061644 | Not Available | 1316 | Open in IMG/M |
| 3300008258|Ga0114840_1021300 | Not Available | 1079 | Open in IMG/M |
| 3300008266|Ga0114363_1000760 | Not Available | 34848 | Open in IMG/M |
| 3300008267|Ga0114364_1030998 | Not Available | 2094 | Open in IMG/M |
| 3300008450|Ga0114880_1000273 | Not Available | 32781 | Open in IMG/M |
| 3300008450|Ga0114880_1205318 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 656 | Open in IMG/M |
| 3300009051|Ga0102864_1126480 | Not Available | 698 | Open in IMG/M |
| 3300009051|Ga0102864_1201726 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 543 | Open in IMG/M |
| 3300009170|Ga0105096_10696654 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 538 | Open in IMG/M |
| 3300009472|Ga0115554_1281485 | Not Available | 660 | Open in IMG/M |
| 3300009908|Ga0132233_101510 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 721 | Open in IMG/M |
| 3300010936|Ga0137784_1007789 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 790 | Open in IMG/M |
| 3300011381|Ga0102688_1670346 | Not Available | 657 | Open in IMG/M |
| 3300012516|Ga0129325_1008786 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 786 | Open in IMG/M |
| 3300012702|Ga0157596_1184875 | Not Available | 620 | Open in IMG/M |
| 3300012706|Ga0157627_1208927 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 1023 | Open in IMG/M |
| 3300012707|Ga0157623_1068351 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 587 | Open in IMG/M |
| 3300012709|Ga0157608_1114696 | Not Available | 504 | Open in IMG/M |
| 3300012719|Ga0157600_1194917 | Not Available | 1449 | Open in IMG/M |
| 3300012730|Ga0157602_1204003 | Not Available | 1826 | Open in IMG/M |
| 3300012757|Ga0157628_1027350 | Not Available | 505 | Open in IMG/M |
| 3300013295|Ga0170791_13669032 | Not Available | 515 | Open in IMG/M |
| 3300016697|Ga0180057_1050540 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 926 | Open in IMG/M |
| 3300016723|Ga0182085_1269713 | Not Available | 1123 | Open in IMG/M |
| 3300016723|Ga0182085_1387475 | Not Available | 1238 | Open in IMG/M |
| 3300016724|Ga0182048_1149949 | Not Available | 1135 | Open in IMG/M |
| 3300016737|Ga0182047_1118476 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 731 | Open in IMG/M |
| 3300016739|Ga0182076_1327665 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 873 | Open in IMG/M |
| 3300016748|Ga0182043_1460235 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 715 | Open in IMG/M |
| 3300016751|Ga0182062_1237168 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 630 | Open in IMG/M |
| 3300017704|Ga0181371_1037820 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 790 | Open in IMG/M |
| 3300017716|Ga0181350_1135680 | Not Available | 582 | Open in IMG/M |
| 3300017763|Ga0181410_1153656 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 646 | Open in IMG/M |
| 3300017772|Ga0181430_1023553 | Not Available | 2010 | Open in IMG/M |
| 3300017774|Ga0181358_1279053 | Not Available | 516 | Open in IMG/M |
| 3300017777|Ga0181357_1196155 | Not Available | 723 | Open in IMG/M |
| 3300017778|Ga0181349_1208274 | Not Available | 672 | Open in IMG/M |
| 3300017784|Ga0181348_1017734 | Not Available | 3049 | Open in IMG/M |
| 3300017786|Ga0181424_10004152 | Not Available | 6347 | Open in IMG/M |
| 3300017786|Ga0181424_10121895 | Not Available | 1123 | Open in IMG/M |
| 3300018041|Ga0181601_10588540 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 571 | Open in IMG/M |
| 3300019266|Ga0182061_1057845 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 705 | Open in IMG/M |
| 3300019276|Ga0182067_1191397 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 518 | Open in IMG/M |
| 3300019784|Ga0181359_1077072 | Not Available | 1255 | Open in IMG/M |
| 3300020160|Ga0211733_11074071 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 532 | Open in IMG/M |
| 3300020165|Ga0206125_10356845 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 538 | Open in IMG/M |
| 3300020172|Ga0211729_11442646 | Not Available | 1187 | Open in IMG/M |
| 3300020190|Ga0194118_10393329 | Not Available | 704 | Open in IMG/M |
| 3300020222|Ga0194125_10751015 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 562 | Open in IMG/M |
| 3300020439|Ga0211558_10534329 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 532 | Open in IMG/M |
| 3300020506|Ga0208091_1025823 | Not Available | 670 | Open in IMG/M |
| 3300021959|Ga0222716_10529168 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 657 | Open in IMG/M |
| 3300022200|Ga0196901_1095589 | Not Available | 1042 | Open in IMG/M |
| 3300023236|Ga0222659_1012514 | Not Available | 1455 | Open in IMG/M |
| 3300023709|Ga0232122_1068563 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 858 | Open in IMG/M |
| 3300024346|Ga0244775_11132824 | Not Available | 612 | Open in IMG/M |
| 3300024480|Ga0255223_1010676 | Not Available | 1420 | Open in IMG/M |
| 3300024531|Ga0255228_1008315 | Not Available | 1834 | Open in IMG/M |
| 3300024533|Ga0256299_1015101 | Not Available | 1430 | Open in IMG/M |
| 3300024568|Ga0255238_1055165 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 968 | Open in IMG/M |
| 3300024569|Ga0255243_1080866 | Not Available | 808 | Open in IMG/M |
| 3300024856|Ga0256304_1044901 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 921 | Open in IMG/M |
| 3300024866|Ga0255272_1167174 | Not Available | 545 | Open in IMG/M |
| 3300025543|Ga0208303_1107543 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 580 | Open in IMG/M |
| 3300025641|Ga0209833_1150800 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 610 | Open in IMG/M |
| 3300025652|Ga0208134_1126495 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 672 | Open in IMG/M |
| 3300026231|Ga0209546_1006141 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 608 | Open in IMG/M |
| 3300026425|Ga0256300_1034202 | Not Available | 716 | Open in IMG/M |
| 3300027772|Ga0209768_10432711 | Not Available | 514 | Open in IMG/M |
| 3300028085|Ga0255255_1078230 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 565 | Open in IMG/M |
| 3300028194|Ga0257106_1269643 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 565 | Open in IMG/M |
| 3300031758|Ga0315907_11142860 | Not Available | 550 | Open in IMG/M |
| 3300031787|Ga0315900_10322340 | Not Available | 1266 | Open in IMG/M |
| 3300031857|Ga0315909_10829935 | Not Available | 580 | Open in IMG/M |
| 3300031951|Ga0315904_11250908 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 565 | Open in IMG/M |
| 3300032093|Ga0315902_10308300 | Not Available | 1492 | Open in IMG/M |
| 3300032116|Ga0315903_11187098 | Not Available | 516 | Open in IMG/M |
| 3300033816|Ga0334980_0122769 | Not Available | 1073 | Open in IMG/M |
| 3300034061|Ga0334987_0043834 | Not Available | 3775 | Open in IMG/M |
| 3300034066|Ga0335019_0628686 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium B17 | 625 | Open in IMG/M |
| 3300034105|Ga0335035_0734247 | Not Available | 502 | Open in IMG/M |
| 3300034418|Ga0348337_069285 | Not Available | 1291 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.88% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.95% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.99% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.99% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.99% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.99% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.99% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.99% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.99% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.99% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.99% |
| Upper Troposphere | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007612 | Marine microbial communities from the Southern Atlantic ocean - KN S19 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009908 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010936 | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016723 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016724 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016751 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019266 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023236 | Saline water microbial communities from Ace Lake, Antarctica - #547 | Environmental | Open in IMG/M |
| 3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300026231 | Upper troposphere microbial communities from California, USA - DAQCA-005 (SPAdes) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300028085 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20151J14362_100154171 | 3300001346 | Pelagic Marine | TKKPVNESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII* |
| Ga0005851_10326521 | 3300003684 | Freshwater And Sediment | ETKTKTTIKESVGFASKAVGVAPAQPIVEGDAAIRRMQQLAGIVK* |
| Ga0068876_103042271 | 3300005527 | Freshwater Lake | VGFASKAVGVAPSQPIVESDAAIRRMQQLAGIIK* |
| Ga0075502_11585962 | 3300006357 | Aqueous | ETKKAMNESKGFASKAAGVAPQKPIVENNDFVARMQKLAGII* |
| Ga0075509_15253492 | 3300006390 | Aqueous | IKDAVTTETKKPVNESRSFASKAAGVAPQKPIVESNDFVARMQKLAGII* |
| Ga0075503_10866772 | 3300006400 | Aqueous | KKPVNESRSFASKAAGVAPKKPIVESNDFVARMQKLAGII* |
| Ga0075486_10489132 | 3300006425 | Aqueous | ESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII* |
| Ga0070749_101762001 | 3300006802 | Aqueous | TKKSSIKESVGFASKAMGVAPAKPIVNEDVQITRMKKLAGIIK* |
| Ga0070746_102620151 | 3300006919 | Aqueous | KSVNESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII* |
| Ga0102689_17917981 | 3300007304 | Freshwater Lake | ESLGFASKASGVAPKSQIVESNDVITRMQKLANIIK* |
| Ga0099851_10931561 | 3300007538 | Aqueous | PVNESRSFASKAAGVAPKKPIVESNDFVARMHKLAGII* |
| Ga0102828_11411131 | 3300007559 | Estuarine | KESLGFASKAAGMAPRKLIVENNEWITRMQKLANINQTN* |
| Ga0102801_13168492 | 3300007612 | Marine | ETKKQVNESRSFASKPTGNAPKKPIVESNDFVSRMQKLAGII* |
| Ga0102899_12019622 | 3300007706 | Estuarine | KESVGFASKAAGVAPKQPIVESDAAIRRMQQLAGIIK* |
| Ga0105745_11227551 | 3300007972 | Estuary Water | KSQFKESLGFASKAAGVAPKNSANSIVESNDVIARMQ* |
| Ga0114340_10154854 | 3300008107 | Freshwater, Plankton | SLGFASKAAGVAPQKQIVEVNETVSRWQMLAGINKF* |
| Ga0114340_10659602 | 3300008107 | Freshwater, Plankton | STIKESLGFASKAAGVAPQKQIVEVNETVSRWQMLAGIK* |
| Ga0114346_11613402 | 3300008113 | Freshwater, Plankton | NTKTKSTIKESVGFASKAAGVAPKQPIVEGDAAIRRMQQLAGIIK* |
| Ga0114350_10616442 | 3300008116 | Freshwater, Plankton | KSTIKESLGFASKADGNAPQKQIVEVNETVSRWQMLAGIK* |
| Ga0114840_10213002 | 3300008258 | Freshwater, Plankton | GFASKAAGMAPQKQIVEVNETVSRWQMLAGINKF* |
| Ga0114363_10007601 | 3300008266 | Freshwater, Plankton | STIKESLGFASKAAGVAPKKQIVEVNDTVARWQMLAGINKF* |
| Ga0114364_10309983 | 3300008267 | Freshwater, Plankton | KKSTIKESLGFASKAAGVAPKKQIVQVDETMSRWQMLAGITKY* |
| Ga0114876_11677961 | 3300008448 | Freshwater Lake | LSESISTKAKNTFKESVGFASKAAGVAPAQPIVESDAAIRRMQQLAGIIK* |
| Ga0114880_10002731 | 3300008450 | Freshwater Lake | KSKKSTIKESLGFASKAAGVAPKKQIVEVNDTVARWQMLAGINKF* |
| Ga0114880_12053181 | 3300008450 | Freshwater Lake | TKTKNTIKESVGFASKAAGIAPAQPIVESDAAIRRMQQLAGIIK* |
| Ga0102864_11264801 | 3300009051 | Estuarine | ESLGFASKAAGIAPSKVIVESNDAIARMQKLANIIK* |
| Ga0102864_12017263 | 3300009051 | Estuarine | SIKESIGFASKAAGVAPKQPIVESDAAIRRMQQLAGIIK* |
| Ga0105096_106966541 | 3300009170 | Freshwater Sediment | TKSTIKESVGFASKAAGVAPKQPIVEGDAAIRRMQQLAGIIK* |
| Ga0115554_12814852 | 3300009472 | Pelagic Marine | MNESKGFASKAAGVAPKKPIVESNDFVARMQKLAGII* |
| Ga0132233_1015101 | 3300009908 | Meromictic Pond | GAKKAVNESRSFASKAAGVAPKTQIVESNDFVKRMQKIAGII* |
| Ga0137784_10077891 | 3300010936 | Marine | DAVTTETKKTVNESRSFASKPTGNAPKKPIVESNDFVSRMQKLAGII* |
| Ga0102688_16703461 | 3300011381 | Freshwater Lake | AAPAKKAIKESLGFASKAVGVAPNKTIVESNDVIARMQKLANIIK* |
| Ga0129325_10087862 | 3300012516 | Aqueous | DAVTTETKKPVNESRSFASKAAGVAPKKPIVENNDFVARMQKLAGII* |
| Ga0157596_11848752 | 3300012702 | Freshwater | AAPKKAIKESLGFASKAAGVAPNKTIVESNDVISRMQKLANIIK* |
| Ga0157627_12089272 | 3300012706 | Freshwater | SIKESVGFASKAVGVAPSQPIVESDAAIRRMQQLAGIIK* |
| Ga0157623_10683512 | 3300012707 | Freshwater | LNSKTVKSSIKESVGFASKAVGVAPSQPIVESDAAIRRMQQLAGIIK* |
| Ga0157608_11146962 | 3300012709 | Freshwater | EIVKESLGFASKAAGVAPKKAIVESDDVITRMQKLANIIK* |
| Ga0157600_11949171 | 3300012719 | Freshwater | KSQIKESLGFASKAAGVAPKSTIVESNDVIARMQKLANIIK* |
| Ga0157602_12040031 | 3300012730 | Freshwater | IKESVGFASKAVGVAPSQPIVESDAAIRRMQQLAGIIK* |
| Ga0157628_10273501 | 3300012757 | Freshwater | SIGFASKAAGVAPKSTIVESNDVIARMQKLANIRL* |
| Ga0170791_136690321 | 3300013295 | Freshwater | IKESLGFASKAAGNAPQKQIVEVNETVSRWQMLAGIK* |
| Ga0180057_10505402 | 3300016697 | Freshwater | SIKESIGFASKAAGVAPKQPIVEGDSAIRRMQQLAGIIK |
| Ga0182085_12697131 | 3300016723 | Salt Marsh | VTTEAKKPVNESRSFASKAAGVAPQKPIVENNYFVARMQKLAGII |
| Ga0182085_13874751 | 3300016723 | Salt Marsh | EAKKPVNESRSFASKAAGVAPQKPIVENNDFVARMQKLAGII |
| Ga0182048_11499492 | 3300016724 | Salt Marsh | KKPVNESRSFASKAAGVAPKTQIVESNDFVARMQKIAGII |
| Ga0182047_11184762 | 3300016737 | Salt Marsh | LKENLNGKKANLKEHKSFASKAAGVAPKQEVITEGADFVSRMQKLAGII |
| Ga0182076_13276651 | 3300016739 | Salt Marsh | ETKKPVNESRSFASKAAGVAPKKPIVESNDFVARMQKLAGII |
| Ga0182043_14602351 | 3300016748 | Salt Marsh | ESRSFASKAAGVAPQKPIVENNDFVARMQKLAGII |
| Ga0182062_12371682 | 3300016751 | Salt Marsh | LTETKKSSIKESVGFASKAMGVAPAKPIVNEDVQITRMKKLAGIIK |
| Ga0181371_10378201 | 3300017704 | Marine | RGFASKAAGVAPKAKQPIVEGDNFVSRMQKLAGIIN |
| Ga0181350_11356801 | 3300017716 | Freshwater Lake | SGKSQIKESLGFASKAAGMAPKNQIVEVNDTLSRMQQLAGIIKY |
| Ga0181410_11536561 | 3300017763 | Seawater | HKSFASKAAGVAPKKDILTEGDNFVNRMQKLAGII |
| Ga0181430_10235533 | 3300017772 | Seawater | NESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII |
| Ga0181358_12790531 | 3300017774 | Freshwater Lake | GAKREIVKESLGFASKAAGVAPKKAIVESDDVITRMQKLANIIK |
| Ga0181357_11961551 | 3300017777 | Freshwater Lake | EKRQIRESLGFASKSTGIVAKPTIVESNDFVARMQKLANIK |
| Ga0181349_12082741 | 3300017778 | Freshwater Lake | AKSKKSTIKESLGFASKAAGVAPKKQIVQVDETMSRWQMLAGITKY |
| Ga0181348_10177341 | 3300017784 | Freshwater Lake | ESIGFASKAAGVAPKQPIVESDAAIRRMQQLAGIIK |
| Ga0181424_100041521 | 3300017786 | Seawater | VNESKGFASKAAGVAPKKPIVESNDFVARMQKLAGII |
| Ga0181424_101218952 | 3300017786 | Seawater | VTTKKSVNESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII |
| Ga0181601_105885401 | 3300018041 | Salt Marsh | TKKSSIKESVGFASKAMGVAPAKPIVNEDVQITRMKKLAGIIK |
| Ga0182061_10578451 | 3300019266 | Salt Marsh | NESKGFASKAAGVAPKTPIVESDNFVARMQKLAGII |
| Ga0182067_11913972 | 3300019276 | Salt Marsh | AVTTETKKAMNESKGFASKAAGVAPKKPIVESNDFVARMQKLAGII |
| Ga0181359_10770721 | 3300019784 | Freshwater Lake | KSAIKESLSFASKAAGVADRKPIVENNDFVARMQKLAGII |
| Ga0211733_110740712 | 3300020160 | Freshwater | SVAPAKNSIKESLSYASKAAGVADRKPIVENNDFVARMQKLAGII |
| Ga0206125_103568452 | 3300020165 | Seawater | IKDTTTKAKTAVNESRSFASKAAGVAETKQPIVESNDFVARMQKLAGII |
| Ga0211729_114426461 | 3300020172 | Freshwater | ESFGFASKATGVAQNRTIVESNDVITRMQKLANIIK |
| Ga0194118_103933292 | 3300020190 | Freshwater Lake | ESLGFASKAAGVAPKKPIVEVDATMSRWQMLAGITKF |
| Ga0194125_107510151 | 3300020222 | Freshwater Lake | ESLTTKTKSTIKESVGFASKAAGVAPAQPIVESDAAIRRMQQLAGIIK |
| Ga0211558_105343291 | 3300020439 | Marine | NESKGFASKAAGVAPKQPIVESNNFVARMQKLAGII |
| Ga0208091_10258232 | 3300020506 | Freshwater | TIKESLGFASKAAGNAPQKQIVQVDETVSRWQMLAGIK |
| Ga0222716_105291682 | 3300021959 | Estuarine Water | TLKDALTETKKSSIKESVGFASKAMGVAPAKPIVNEDVQITRMKKLAGIIK |
| Ga0196901_10955891 | 3300022200 | Aqueous | AVTMEAKKPVNESRSFASKAAGVAPKTQIVESNDFVARMQKIAGII |
| Ga0222659_10125141 | 3300023236 | Saline Water | SRSFASKAVGVAPKTQIVEGNDFVARMQKLAGINKF |
| Ga0232122_10685632 | 3300023709 | Salt Marsh | TTKKPVNESKGFASKAAGVAPKTPIVESDNFVARMQKLAGII |
| Ga0244775_111328242 | 3300024346 | Estuarine | TATSGNKTQIKESLGFASKAAGVAPKKQIVEVNDNISRMQMLAGIK |
| Ga0255223_10106761 | 3300024480 | Freshwater | ETKKQNIKESVGFASKAAGVAPAQPIVEGDAAIRRMQQLAGIIK |
| Ga0255228_10083151 | 3300024531 | Freshwater | KESVGFASKPMGVAPAKTIVNEDVQVTRMKKLAGIIK |
| Ga0256299_10151011 | 3300024533 | Freshwater | SVGFASKAAGVAPAQPIVEGDAAIRRMQQLAGIIK |
| Ga0255238_10551651 | 3300024568 | Freshwater | IKESIGFASKAAGVAPKQPIVESDAAIRRMQQLAGIIK |
| Ga0255243_10808662 | 3300024569 | Freshwater | KFLRLFASKATGIAPKKQMIVESNDFIARMQKLANITK |
| Ga0256304_10449012 | 3300024856 | Freshwater | STKKSSIKESIGFASKAAGVAPKQPIVESDAAIRRMQQLAGIIK |
| Ga0255272_11671741 | 3300024866 | Freshwater | TIKESLGFASKAAGVAPQKQIVEVNETVSRWQMLAGIK |
| Ga0208303_11075432 | 3300025543 | Aqueous | KKSVNESKGFASKAAGVAPKAPIVESDNFVARMQKLAGII |
| Ga0209833_11508002 | 3300025641 | Pelagic Marine | DSVTTGAKKAVNESRSFASKAAGVAPKTQIVESNDFVKRMQKIAGII |
| Ga0208134_11264951 | 3300025652 | Aqueous | ESKGFASKAAGVAPKQVLVEENNFVARMQKLAGII |
| Ga0209546_10061411 | 3300026231 | Upper Troposphere | KESLSFASKPAGMAPNRQPIVENDDFVKRMQKIAGII |
| Ga0256300_10342021 | 3300026425 | Freshwater | IKESLGFASKAAGVAPKNSANSIVESNDVIARMQKLANIIK |
| Ga0209768_104327111 | 3300027772 | Freshwater Lake | ESLGFASKAAGVAPKNSANSIVESNDVIARMQKLANIIK |
| Ga0255255_10782301 | 3300028085 | Freshwater | NTKVTKSSIKESVGFASKAVGVAPSQPIVESDAAIRRMQQLAGIIK |
| Ga0257106_12696431 | 3300028194 | Marine | TKSPIKENLGSASKAAGVAQHRKPIVEIDSQVSRWQKLAGIK |
| Ga0315907_111428601 | 3300031758 | Freshwater | KKAIKESLGFASKAAGVAPNKSIVESNDVISRMQKLANIK |
| Ga0315900_103223401 | 3300031787 | Freshwater | LGFASKAAGIAPKKPIVEVDATVSRWQMLAGINKF |
| Ga0315909_108299352 | 3300031857 | Freshwater | IVKESLGFASKAAGMAPQKPIVEVDDTVSRWKMLAGITKF |
| Ga0315904_112509082 | 3300031951 | Freshwater | EALNTKTKSTIKESVGFASKAAGVAPKQPIVEGDSAIRRMQQLAGIIK |
| Ga0315902_103083002 | 3300032093 | Freshwater | ESLGFASKAAGVAPQKQIVEVNETVSRWQMLAGIK |
| Ga0315903_111870982 | 3300032116 | Freshwater | SAKKTQIKESIGFASKAAGVAPKQQIIESNDVISRMQRLANIK |
| Ga0334980_0122769_1_132 | 3300033816 | Freshwater | KSTKNTIKESLGFASKAAGMAPQKQIVEVNETVSRWQMLAGIK |
| Ga0334987_0043834_3667_3774 | 3300034061 | Freshwater | SIGFASKAAGVAPKQPIVEGDSAIRRMQQLAGIIK |
| Ga0335019_0628686_504_623 | 3300034066 | Freshwater | TALKESIGFASKAAGVAPKGNTVEADPFITRMQKLAGII |
| Ga0335035_0734247_1_114 | 3300034105 | Freshwater | KESFGFASKATGVAQNRTIVESNDVITRMQKLANIIK |
| Ga0348337_069285_1166_1291 | 3300034418 | Aqueous | TKKPVNESRSFASKAAGVAPKKPIVESNDFVARMQKLAGII |
| ⦗Top⦘ |