| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006885 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117890 | Gp0125669 | Ga0102512 |
| Sample Name | Final time point T34 (3) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 49588317 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → oil reservoir → sand |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043480 | Metagenome / Metatranscriptome | 156 | Y |
| F080090 | Metagenome / Metatranscriptome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102512_100002 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 412343 | Open in IMG/M |
| Ga0102512_105136 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1316 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102512_100002 | Ga0102512_100002175 | F043480 | MNKILFISGLCIALAAAALLFLNIIESGVAAVIGIVGIGLIAASGRL* |
| Ga0102512_105136 | Ga0102512_1051361 | F080090 | LEMSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISISRT* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |