


| Basic Information | |
|---|---|
| Family ID | F043480 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIGASGRL |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 81.33 % |
| % of genes near scaffold ends (potentially truncated) | 17.31 % |
| % of genes from short scaffolds (< 2000 bps) | 68.59 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (54.487 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (16.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.821 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.590 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.29.16.1: IVS-encoded protein-like | d2rlda1 | 2rld | 0.79905 |
| a.2.17.1: VPS23 C-terminal domain | d2f6ma2 | 2f6m | 0.79425 |
| a.266.1.2: Indoleamine 2,3-dioxygenase-like | d2nwba1 | 2nwb | 0.79212 |
| a.29.6.1: Plant invertase/pectin methylesterase inhibitor | d2cj4a_ | 2cj4 | 0.77682 |
| a.127.1.1: L-aspartase/fumarase | d7miwa1 | 7miw | 0.77475 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 3.23 |
| PF02943 | FeThRed_B | 2.58 |
| PF00440 | TetR_N | 1.94 |
| PF13414 | TPR_11 | 1.94 |
| PF09932 | DUF2164 | 1.94 |
| PF03724 | META | 1.29 |
| PF07784 | DUF1622 | 1.29 |
| PF00301 | Rubredoxin | 1.29 |
| PF04191 | PEMT | 1.29 |
| PF02086 | MethyltransfD12 | 1.29 |
| PF16916 | ZT_dimer | 1.29 |
| PF07998 | Peptidase_M54 | 1.29 |
| PF13391 | HNH_2 | 1.29 |
| PF00016 | RuBisCO_large | 1.29 |
| PF03008 | DUF234 | 1.29 |
| PF05649 | Peptidase_M13_N | 1.29 |
| PF01964 | ThiC_Rad_SAM | 0.65 |
| PF00072 | Response_reg | 0.65 |
| PF09888 | DUF2115 | 0.65 |
| PF04993 | TfoX_N | 0.65 |
| PF11972 | HTH_13 | 0.65 |
| PF00682 | HMGL-like | 0.65 |
| PF04055 | Radical_SAM | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| PF14076 | DUF4258 | 0.65 |
| PF12399 | BCA_ABC_TP_C | 0.65 |
| PF01954 | AF2212-like | 0.65 |
| PF04885 | Stig1 | 0.65 |
| PF00696 | AA_kinase | 0.65 |
| PF04167 | DUF402 | 0.65 |
| PF14367 | DUF4411 | 0.65 |
| PF00174 | Oxidored_molyb | 0.65 |
| PF13646 | HEAT_2 | 0.65 |
| PF04024 | PspC | 0.65 |
| PF13507 | GATase_5 | 0.65 |
| PF08502 | LeuA_dimer | 0.65 |
| PF00801 | PKD | 0.65 |
| PF16795 | Phage_integr_3 | 0.65 |
| PF05013 | FGase | 0.65 |
| PF16264 | SatD | 0.65 |
| PF01814 | Hemerythrin | 0.65 |
| PF13187 | Fer4_9 | 0.65 |
| PF13181 | TPR_8 | 0.65 |
| PF13371 | TPR_9 | 0.65 |
| PF14401 | RLAN | 0.65 |
| PF12762 | DDE_Tnp_IS1595 | 0.65 |
| PF04893 | Yip1 | 0.65 |
| PF01176 | eIF-1a | 0.65 |
| PF13649 | Methyltransf_25 | 0.65 |
| PF08734 | GYD | 0.65 |
| PF01391 | Collagen | 0.65 |
| PF10604 | Polyketide_cyc2 | 0.65 |
| PF13540 | RCC1_2 | 0.65 |
| PF02653 | BPD_transp_2 | 0.65 |
| PF09897 | DUF2124 | 0.65 |
| PF13328 | HD_4 | 0.65 |
| PF00515 | TPR_1 | 0.65 |
| PF00141 | peroxidase | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.23 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.23 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.23 |
| COG4802 | Ferredoxin-thioredoxin reductase, catalytic subunit | Energy production and conversion [C] | 2.58 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.29 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 1.29 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 1.29 |
| COG1913 | Predicted Zn-dependent protease | General function prediction only [R] | 1.29 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 1.29 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.29 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.29 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 1.29 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.65 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.65 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.65 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.65 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.65 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.65 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.65 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.46 % |
| Unclassified | root | N/A | 36.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876020|2244392223 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1603 | Open in IMG/M |
| 3300000032|Draft_c0006280 | Not Available | 13390 | Open in IMG/M |
| 3300000032|Draft_c0069272 | All Organisms → cellular organisms → Archaea | 7966 | Open in IMG/M |
| 3300000032|Draft_c0126071 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 4424 | Open in IMG/M |
| 3300000568|Draft_10030993 | Not Available | 1674 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100865063 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 700 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107943525 | Not Available | 702 | Open in IMG/M |
| 3300001567|Draft_10000138 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 136502 | Open in IMG/M |
| 3300001567|Draft_10023291 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2943 | Open in IMG/M |
| 3300001580|Draft_10011688 | Not Available | 7367 | Open in IMG/M |
| 3300001580|Draft_10053202 | All Organisms → cellular organisms → Archaea | 2545 | Open in IMG/M |
| 3300002219|SCADCLC_10078487 | Not Available | 9328 | Open in IMG/M |
| 3300002703|draft_11039077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1667 | Open in IMG/M |
| 3300002703|draft_11076164 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 4411 | Open in IMG/M |
| 3300003432|JGI20214J51088_10095430 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2092 | Open in IMG/M |
| 3300003541|JGI20214J51650_10147575 | Not Available | 1613 | Open in IMG/M |
| 3300003858|Ga0031656_10028671 | Not Available | 2303 | Open in IMG/M |
| 3300003859|Ga0031653_10029118 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300004012|Ga0055464_10209936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter → Prolixibacter bellariivorans | 581 | Open in IMG/M |
| 3300004063|Ga0055483_10142669 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → Methanoculleus marisnigri | 761 | Open in IMG/M |
| 3300004063|Ga0055483_10220408 | All Organisms → cellular organisms → Archaea | 619 | Open in IMG/M |
| 3300004481|Ga0069718_10158253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Prolixibacter → Prolixibacter bellariivorans | 673 | Open in IMG/M |
| 3300004481|Ga0069718_11175978 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 518 | Open in IMG/M |
| 3300005144|Ga0068711_1005807 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 4971 | Open in IMG/M |
| 3300005144|Ga0068711_1016954 | All Organisms → cellular organisms → Archaea | 2163 | Open in IMG/M |
| 3300005144|Ga0068711_1036310 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanolinea → Methanolinea tarda | 1204 | Open in IMG/M |
| 3300005144|Ga0068711_1036396 | Not Available | 1202 | Open in IMG/M |
| 3300005144|Ga0068711_1039090 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300005144|Ga0068711_1051529 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 934 | Open in IMG/M |
| 3300005144|Ga0068711_1064619 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005832|Ga0074469_10394833 | Not Available | 546 | Open in IMG/M |
| 3300006224|Ga0079037_100051372 | Not Available | 3226 | Open in IMG/M |
| 3300006224|Ga0079037_102457907 | Not Available | 520 | Open in IMG/M |
| 3300006885|Ga0102512_100002 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 412343 | Open in IMG/M |
| 3300006930|Ga0079303_10112346 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1038 | Open in IMG/M |
| 3300006930|Ga0079303_10435094 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 560 | Open in IMG/M |
| 3300009091|Ga0102851_10388207 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1400 | Open in IMG/M |
| 3300009091|Ga0102851_10412259 | Not Available | 1363 | Open in IMG/M |
| 3300009091|Ga0102851_10452905 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1307 | Open in IMG/M |
| 3300009091|Ga0102851_10972743 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 921 | Open in IMG/M |
| 3300009091|Ga0102851_11118826 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 863 | Open in IMG/M |
| 3300009091|Ga0102851_12588815 | Not Available | 581 | Open in IMG/M |
| 3300009091|Ga0102851_13198687 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 526 | Open in IMG/M |
| 3300009111|Ga0115026_10143361 | Not Available | 1528 | Open in IMG/M |
| 3300009111|Ga0115026_10156358 | Not Available | 1476 | Open in IMG/M |
| 3300009111|Ga0115026_10255825 | Not Available | 1202 | Open in IMG/M |
| 3300009131|Ga0115027_10986597 | Not Available | 658 | Open in IMG/M |
| 3300009167|Ga0113563_12467872 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanomicrobium → unclassified Methanomicrobium → Methanomicrobium sp. | 627 | Open in IMG/M |
| 3300009179|Ga0115028_10336353 | Not Available | 1032 | Open in IMG/M |
| 3300009179|Ga0115028_11392105 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 589 | Open in IMG/M |
| 3300009388|Ga0103809_1000012 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 130458 | Open in IMG/M |
| 3300009666|Ga0116182_1034942 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 3042 | Open in IMG/M |
| 3300009666|Ga0116182_1054018 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 2248 | Open in IMG/M |
| 3300009674|Ga0116173_1061072 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2055 | Open in IMG/M |
| 3300009674|Ga0116173_1437944 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoplanus | 560 | Open in IMG/M |
| 3300009681|Ga0116174_10366543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_47_9 | 677 | Open in IMG/M |
| 3300009687|Ga0116144_10037725 | Not Available | 3067 | Open in IMG/M |
| 3300009689|Ga0116186_1141095 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1135 | Open in IMG/M |
| 3300009693|Ga0116141_10321028 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 813 | Open in IMG/M |
| 3300009781|Ga0116178_10010105 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 6309 | Open in IMG/M |
| 3300009782|Ga0116157_10049545 | Not Available | 2767 | Open in IMG/M |
| 3300009782|Ga0116157_10592379 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 559 | Open in IMG/M |
| 3300010353|Ga0116236_10074707 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3415 | Open in IMG/M |
| 3300012018|Ga0119867_1183622 | Not Available | 555 | Open in IMG/M |
| 3300012931|Ga0153915_10013644 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus | 7841 | Open in IMG/M |
| 3300012931|Ga0153915_10085994 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3307 | Open in IMG/M |
| 3300012931|Ga0153915_10325353 | Not Available | 1723 | Open in IMG/M |
| 3300012931|Ga0153915_10537771 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1339 | Open in IMG/M |
| 3300012931|Ga0153915_10703430 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1167 | Open in IMG/M |
| 3300012931|Ga0153915_10725369 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum → unclassified Nitrosarchaeum → Nitrosarchaeum sp. AC2 | 1149 | Open in IMG/M |
| 3300012931|Ga0153915_10801967 | Not Available | 1091 | Open in IMG/M |
| 3300012931|Ga0153915_11120162 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 918 | Open in IMG/M |
| 3300012931|Ga0153915_11660844 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 747 | Open in IMG/M |
| 3300012931|Ga0153915_12075964 | Not Available | 665 | Open in IMG/M |
| 3300012931|Ga0153915_12128050 | Not Available | 657 | Open in IMG/M |
| 3300012964|Ga0153916_10296080 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1652 | Open in IMG/M |
| 3300012964|Ga0153916_10599509 | Not Available | 1178 | Open in IMG/M |
| 3300012964|Ga0153916_10783478 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1033 | Open in IMG/M |
| 3300012964|Ga0153916_12298600 | Not Available | 606 | Open in IMG/M |
| 3300012964|Ga0153916_13238449 | Not Available | 512 | Open in IMG/M |
| 3300013086|Ga0163202_1004854 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2526 | Open in IMG/M |
| 3300014205|Ga0172380_10021879 | All Organisms → cellular organisms → Bacteria | 5937 | Open in IMG/M |
| 3300025563|Ga0210112_1111642 | Not Available | 560 | Open in IMG/M |
| 3300025708|Ga0209201_1000061 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 166217 | Open in IMG/M |
| 3300025720|Ga0208197_1049550 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1723 | Open in IMG/M |
| 3300025748|Ga0208459_1030446 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2646 | Open in IMG/M |
| 3300025784|Ga0209200_1008990 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 6653 | Open in IMG/M |
| 3300025859|Ga0209096_1217243 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 715 | Open in IMG/M |
| 3300025952|Ga0210077_1062145 | All Organisms → cellular organisms → Archaea | 773 | Open in IMG/M |
| 3300027051|Ga0209269_1001328 | All Organisms → cellular organisms → Archaea | 13523 | Open in IMG/M |
| 3300027051|Ga0209269_1002881 | All Organisms → cellular organisms → Archaea | 6859 | Open in IMG/M |
| 3300027051|Ga0209269_1006460 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 3665 | Open in IMG/M |
| 3300027051|Ga0209269_1010962 | Not Available | 2460 | Open in IMG/M |
| 3300027051|Ga0209269_1025371 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1247 | Open in IMG/M |
| 3300027051|Ga0209269_1025958 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300027051|Ga0209269_1040609 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 844 | Open in IMG/M |
| 3300027051|Ga0209269_1041320 | Not Available | 833 | Open in IMG/M |
| 3300027051|Ga0209269_1066421 | Not Available | 570 | Open in IMG/M |
| 3300027796|Ga0209373_10376851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
| 3300027877|Ga0209293_10046462 | Not Available | 1757 | Open in IMG/M |
| 3300027877|Ga0209293_10287879 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 831 | Open in IMG/M |
| 3300027885|Ga0209450_10122725 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 1758 | Open in IMG/M |
| 3300027885|Ga0209450_10839585 | Not Available | 660 | Open in IMG/M |
| 3300027897|Ga0209254_10104992 | All Organisms → cellular organisms → Archaea | 2365 | Open in IMG/M |
| 3300027899|Ga0209668_10382102 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 919 | Open in IMG/M |
| 3300027899|Ga0209668_10780504 | Not Available | 643 | Open in IMG/M |
| 3300027900|Ga0209253_10023048 | Not Available | 5241 | Open in IMG/M |
| 3300027900|Ga0209253_10067906 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2942 | Open in IMG/M |
| 3300027900|Ga0209253_10072713 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300027900|Ga0209253_10185162 | Not Available | 1670 | Open in IMG/M |
| 3300027900|Ga0209253_10185162 | Not Available | 1670 | Open in IMG/M |
| 3300027900|Ga0209253_11021694 | Not Available | 569 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1082783 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300028634|Ga0302242_1062273 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300028883|Ga0272443_10027031 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus | 4062 | Open in IMG/M |
| 3300031539|Ga0307380_10125406 | Not Available | 2595 | Open in IMG/M |
| 3300031565|Ga0307379_10055562 | All Organisms → cellular organisms → Archaea | 4518 | Open in IMG/M |
| 3300031566|Ga0307378_10533555 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300031873|Ga0315297_10952232 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 711 | Open in IMG/M |
| 3300031997|Ga0315278_10279507 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1724 | Open in IMG/M |
| 3300032053|Ga0315284_10732357 | Not Available | 1156 | Open in IMG/M |
| 3300032053|Ga0315284_11554875 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 698 | Open in IMG/M |
| 3300032118|Ga0315277_10131137 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2797 | Open in IMG/M |
| 3300032118|Ga0315277_10636713 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1039 | Open in IMG/M |
| 3300032118|Ga0315277_11397755 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanolinea → unclassified Methanolinea → Methanolinea sp. | 606 | Open in IMG/M |
| 3300032516|Ga0315273_12390991 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanolinea → unclassified Methanolinea → Methanolinea sp. | 613 | Open in IMG/M |
| 3300033408|Ga0316605_11319598 | Not Available | 698 | Open in IMG/M |
| 3300033408|Ga0316605_11909656 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 578 | Open in IMG/M |
| 3300033413|Ga0316603_11011579 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 785 | Open in IMG/M |
| 3300033413|Ga0316603_11174828 | Not Available | 727 | Open in IMG/M |
| 3300033414|Ga0316619_10915644 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 758 | Open in IMG/M |
| 3300033414|Ga0316619_11472071 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 610 | Open in IMG/M |
| 3300033414|Ga0316619_11670006 | Not Available | 575 | Open in IMG/M |
| 3300033419|Ga0316601_100276784 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1523 | Open in IMG/M |
| 3300033419|Ga0316601_100857336 | Not Available | 901 | Open in IMG/M |
| 3300033419|Ga0316601_102542572 | Not Available | 515 | Open in IMG/M |
| 3300033434|Ga0316613_11156213 | Not Available | 533 | Open in IMG/M |
| 3300033480|Ga0316620_12477251 | Not Available | 516 | Open in IMG/M |
| 3300033483|Ga0316629_10340225 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 1032 | Open in IMG/M |
| 3300033485|Ga0316626_10450473 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1086 | Open in IMG/M |
| 3300033486|Ga0316624_11052586 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 735 | Open in IMG/M |
| 3300033487|Ga0316630_10098597 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 1950 | Open in IMG/M |
| 3300033487|Ga0316630_10950223 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 748 | Open in IMG/M |
| 3300033488|Ga0316621_10457836 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 883 | Open in IMG/M |
| 3300033488|Ga0316621_10750585 | Not Available | 709 | Open in IMG/M |
| 3300033488|Ga0316621_11410311 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 532 | Open in IMG/M |
| 3300033493|Ga0316631_10318923 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 627 | Open in IMG/M |
| 3300033521|Ga0316616_100844969 | Not Available | 1121 | Open in IMG/M |
| 3300033521|Ga0316616_104698471 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.BinA087 | 514 | Open in IMG/M |
| 3300033991|Ga0334965_0038973 | Not Available | 2321 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 16.03% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 10.90% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 10.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 10.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 8.33% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.05% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.77% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 5.77% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.13% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.21% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.92% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.28% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.64% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.64% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.64% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.64% |
| Oil Sands | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands | 0.64% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.64% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.64% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.64% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876020 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001567 | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002219 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005144 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG | Engineered | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006885 | Final time point T34 (3) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009388 | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013086 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m | Environmental | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028634 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Lys | Engineered | Open in IMG/M |
| 3300028883 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2244013983 | 2236876020 | Hydrocarbon Resource Environments | MNKILFMVGLSIALAAAALLFLNIIESGVAAIIGIIGLGLIAVSR |
| Draft_00062803 | 3300000032 | Hydrocarbon Resource Environments | MNKTLFIAGLCIALAAAALLFLDIIESGVAALVGFIGIGLIAVSGSPKPRC* |
| Draft_00692722 | 3300000032 | Hydrocarbon Resource Environments | MHKILFLAGLCITLTSAALLFFGILEPGLAAMVGIVGIGLIAASGMSNIKRL* |
| Draft_01260712 | 3300000032 | Hydrocarbon Resource Environments | MNKILFMVGLSIALAAAALLFLNIIESGVAAIIGIIGLGLIAVSR* |
| Draft_100309932 | 3300000568 | Hydrocarbon Resource Environments | MHKILFLAGLCITLTSAALLFFGILEPGXAAMVGIVGIGLIAASGMSNIKRL* |
| JGIcombinedJ13530_1008650632 | 3300001213 | Wetland | MNLKSMHMNKILFMVGLYIAFAASALLFLNIIESGVAAVIGILGIGLIAASGSSKIKRLKIESWGL* |
| JGIcombinedJ13530_1079435252 | 3300001213 | Wetland | MNKILFIAGLCIALGAAGLLFLNIIESGVAAVIGILGIGLIATSGRL* |
| Draft_1000013852 | 3300001567 | Hydrocarbon Resource Environments | MNKILFIVGLTIALAAASLLFLNIIESGVAAMIGIIGIGLIAVSR* |
| Draft_100232912 | 3300001567 | Hydrocarbon Resource Environments | MKKILFMVGLCIALGAAALLFLDIIESGVAAMIGIVGIGLIGASGISNIKRL* |
| Draft_1001168813 | 3300001580 | Hydrocarbon Resource Environments | KSFKEGENETPMHKILFPAGLCITLTSAALLFLGILEPGVAALVGIVGIGLIAASGMSNIXXL* |
| Draft_100532024 | 3300001580 | Hydrocarbon Resource Environments | MHKILFLAGLCIALTSAALLFFGILEPGLAAMIGIVGIGLIAASGMSNIKRL* |
| SCADCLC_1007848711 | 3300002219 | Hydrocarbon Resource Environments | MNKILFIVGLCIALAVAALLFFNIIESGVAAVIGIPGIGLIGASGSSKIKRL* |
| draft_110390773 | 3300002703 | Hydrocarbon Resource Environments | MNKILFIVGLCIAIGAAALLFLDIIESGVAALIGIVGIGLIGASGISNIKRL* |
| draft_110761641 | 3300002703 | Hydrocarbon Resource Environments | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIAASHVDRKSSGCK* |
| JGI20214J51088_100954304 | 3300003432 | Wetland | MNKILVIVGLCIALAAAALLFLXSIESGVATVIGIMGIGLIAASGYSTIKRL* |
| JGI20214J51650_101475751 | 3300003541 | Wetland | MNKILVIVGLCIALAAAALLFLRSIESGVATVIGIMGIGLIAASGYSTIKRL* |
| Ga0031656_100286711 | 3300003858 | Freshwater Lake Sediment | MNKILFMVGLCIALGAGALLFLDIIESGAAAMIGIIGIGLIGASGISNIKRL* |
| Ga0031653_100291184 | 3300003859 | Freshwater Lake Sediment | MNKILFIVGLCIALGAAALLFLDIIESGVAAMIGIIGIGLIGASGISNIKRL* |
| Ga0055464_102099361 | 3300004012 | Natural And Restored Wetlands | MNKILFTVGLCIALAAAALLFLNIIESGVAALIGILGIGLIGASGIDRKSSGGE* |
| Ga0055483_101426691 | 3300004063 | Natural And Restored Wetlands | MNKILFIVGLCIALGAATLLFFGIIESGVAAMIGIIGIGLIAVSGISDIKRM* |
| Ga0055483_102204082 | 3300004063 | Natural And Restored Wetlands | MNKILFIVGLCIALVAAALLFLNIIESGVAAVIGILGIGLIGASGSSKIKRFK* |
| Ga0066602_102111181 | 3300004151 | Freshwater | MNIKLFIPGLLIVAIAATLLLLNVIESGVAAAIGILGIGLIAASGKRKTK* |
| Ga0066603_100765314 | 3300004154 | Freshwater | MNIKLFIPGLLIVAIAATLLLLNVIESGVAAAIGILGIGLIAASGKRK |
| Ga0069718_101582531 | 3300004481 | Sediment | VNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASHADRKSSGCN* |
| Ga0069718_111759781 | 3300004481 | Sediment | MHKILFLAGLCIALTSAALLFFGIIEPGLAAMIGIVGIGLIAASGMSNIKRL* |
| Ga0068711_10058075 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAAALLFLDIIESGVAAMIGILGIGLIAASSVDRKSSGCK* |
| Ga0068711_10169545 | 3300005144 | Enrichment Culture | MNKPLFIAAVCIAVAAASLLFLNIIESGIAAVIGILGIGLIALSGRL* |
| Ga0068711_10363101 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAASLLFLNIIESGVAAVIGILGIGLIAASGRV* |
| Ga0068711_10363963 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIAASGRSKPSGCK* |
| Ga0068711_10390902 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGIVGIGLIAASGTVDRKSSGCK* |
| Ga0068711_10515292 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAASLLFLSIIESGVAAVIGILGIGLIGASGRI* |
| Ga0068711_10646192 | 3300005144 | Enrichment Culture | MNKILFIVGLCIALAAASLLFLNIIESGVAAVIGILGIGLIAASGRI* |
| Ga0074469_103948331 | 3300005832 | Sediment (Intertidal) | MNKILFIVGLCIALAAAVLLFLNIIESGVAAMIGILGIGLIVASSVDRKSSGCK* |
| Ga0079037_1000513726 | 3300006224 | Freshwater Wetlands | MNKILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIAVSGRL* |
| Ga0079037_1024579071 | 3300006224 | Freshwater Wetlands | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIG |
| Ga0102512_100002175 | 3300006885 | Oil Sands | MNKILFISGLCIALAAAALLFLNIIESGVAAVIGIVGIGLIAASGRL* |
| Ga0079303_101123462 | 3300006930 | Deep Subsurface | MNKILFIVGLCIALAAAALLFLNILESGVAALIGILGIGLIAVSGRL* |
| Ga0079303_104350942 | 3300006930 | Deep Subsurface | MNKILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIGASGLSNIKRL* |
| Ga0102851_103882073 | 3300009091 | Freshwater Wetlands | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGISNIKRL* |
| Ga0102851_104122592 | 3300009091 | Freshwater Wetlands | MNKILFIVGLCIALSAVTLLFLDIIESGVAAMIGIIGIGL |
| Ga0102851_104529052 | 3300009091 | Freshwater Wetlands | MNKILFIVRLCIALAAAALLFLNILESGVAAVIGILGIGLIAVSGRL* |
| Ga0102851_109727431 | 3300009091 | Freshwater Wetlands | MNKILFIAGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGLSNIKRL* |
| Ga0102851_111188263 | 3300009091 | Freshwater Wetlands | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGMSNSRRL* |
| Ga0102851_125888151 | 3300009091 | Freshwater Wetlands | FGKLPLKNEIVEGTYVNKILFIIGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSHADRKSSGCK* |
| Ga0102851_131986871 | 3300009091 | Freshwater Wetlands | MKKILFIVGLCIALTAAALLFLNIIESGVAAVIGILGIGLIGASHADRKSSGCK* |
| Ga0115026_101433613 | 3300009111 | Wetland | MNKTLFIVGLCIAFGAAALLFFDIIESGVAALIGIVGIGLIGASGISNIKRL* |
| Ga0115026_101563583 | 3300009111 | Wetland | MNKILFIVGLCIALAAAALLFFNILESGVAALIGILGIGLIAVSGRL* |
| Ga0115026_102558251 | 3300009111 | Wetland | MNKILFIAGLCIALGAAGLLLLNIIESGVAAVIGILGIGLIATSGRL* |
| Ga0115027_109865971 | 3300009131 | Wetland | MNKILFIVGLCIALVAAALLFLNIIESGVAAMIGILGIGLIATSGRL* |
| Ga0113563_110650072 | 3300009167 | Freshwater Wetlands | VNKILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSLADRKSSGCNERVECYQRDWIIFL* |
| Ga0113563_124678722 | 3300009167 | Freshwater Wetlands | MNKILFIVGLCIALAAAALLFLNILESGVAALIGILGIGLIAISGRL* |
| Ga0115028_103363532 | 3300009179 | Wetland | MVFDRSHMNKILFIAGLSIALTAAALLVLNIIESGVAAMIGIIGIGLIAVSGRL* |
| Ga0115028_113921051 | 3300009179 | Wetland | MNKILFIVGLCIALAAAALLFLNILESGVAALIGIIGI |
| Ga0103809_100001298 | 3300009388 | Enrichment Culture | MHKILFLAGLCIALTSAALLFFGIIEPGLAAMIGIVGIGLIAASGMSHIKRL* |
| Ga0116182_10349422 | 3300009666 | Anaerobic Digestor Sludge | MNRILFITGLCIALMAAALLFFSIIEPGVAAIIGILGIGLIAASGMSHIKRM* |
| Ga0116182_10540181 | 3300009666 | Anaerobic Digestor Sludge | MNKILFLAGLCIALTAAALLFFGLIEPGPAAVIGIVGIGLIGASGVSNIKRL* |
| Ga0116173_10610723 | 3300009674 | Anaerobic Digestor Sludge | GLGIALTSAALLFFGIIEPGVAAMVGILGIGLIGMSHIKRM* |
| Ga0116173_14379441 | 3300009674 | Anaerobic Digestor Sludge | MNKILFTIGLFIALGAAALLFLHIIESGVAAVIGILGIGVIAVSGQLKGNG* |
| Ga0116174_103665431 | 3300009681 | Anaerobic Digestor Sludge | FLAGLCIALTAAALLFFDVIEPGHAAVIGIVGIGLIGASGMSHIRRL* |
| Ga0116144_100377253 | 3300009687 | Anaerobic Digestor Sludge | MNKILFLVGLCIALTSAALLFFGLIEPGPAAVIGIVGIGLIGASGMSHIRRL* |
| Ga0116186_11410952 | 3300009689 | Anaerobic Digestor Sludge | MHKILFIAGLGIALTSSALLFFGIIEPGVAAMVGILGIGLIGMSHIKRM* |
| Ga0116141_103210282 | 3300009693 | Anaerobic Digestor Sludge | MHKILFIAGLGIALTSAALLFFGIIEPGVAAMVGILGIGLIGMSHIKRM* |
| Ga0116178_100101054 | 3300009781 | Anaerobic Digestor Sludge | MNIALFLAGLCIALTAAALLFFDIIEPGLAAVIGIVGIGLIGASGMSHIRRL* |
| Ga0116157_100495453 | 3300009782 | Anaerobic Digestor Sludge | MNKILFLAGLCIALVAAALLFFGLIEPGPAAVIGIVGIGLIGASGVSNIKRL* |
| Ga0116157_105923792 | 3300009782 | Anaerobic Digestor Sludge | MLFIAGLCIALTSAALLFFDIIEAGVAAMVGILGIGLIGASGMSHIKRL* |
| Ga0116236_100747074 | 3300010353 | Anaerobic Digestor Sludge | MNTMLFIAGLCIALTSAALLFFDIIEAGVAAMVGILGIGLIGASGMSHIKRL* |
| Ga0119867_11836222 | 3300012018 | Activated Sludge | MNKTLFVIGLLIAGLAAVLLLMNVIESGVAAAIGILGIGLIAA |
| Ga0153915_100136448 | 3300012931 | Freshwater Wetlands | MNRILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIAVSGRL* |
| Ga0153915_100859944 | 3300012931 | Freshwater Wetlands | MNKILFIVGLWIALVAAALLFLNIIESGVAAVIGILGIGLIGASGSSKIKRL* |
| Ga0153915_103253532 | 3300012931 | Freshwater Wetlands | MNKILFIVGLCIALAAAALLFFNIIESGVAAVIGILGIGLIATSGRLDRK* |
| Ga0153915_105377713 | 3300012931 | Freshwater Wetlands | MNKILFLILYIGGLCIALGAAALLFFGIIESGVAAMIGIIGIALISGSGISIFMRP* |
| Ga0153915_107034302 | 3300012931 | Freshwater Wetlands | MNKILFIVGLCIALAAAAFLFLNIIESGVAAMIGILGIGLIGASSVDRKSSGCK* |
| Ga0153915_107253693 | 3300012931 | Freshwater Wetlands | MNKILFIVGLCIAVTAAALLFLDIIESGVAAMIGIVGIGLIGASGISNIKRL* |
| Ga0153915_108019672 | 3300012931 | Freshwater Wetlands | MNKILFIAGLCIALAAAALLFFNIIESGVAALIGILGIGLIATSGRLDRK* |
| Ga0153915_111201623 | 3300012931 | Freshwater Wetlands | MNKILFIIGLCIALTAAALLFLNLIESGVAAVIGILGIGLIAVSGRL* |
| Ga0153915_116608441 | 3300012931 | Freshwater Wetlands | MNKILFIVGLGIALAAAALLFLNIIESGVAAMIGILGIGLIAASHVDRKSSGCK* |
| Ga0153915_120759641 | 3300012931 | Freshwater Wetlands | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASSVDR |
| Ga0153915_121280502 | 3300012931 | Freshwater Wetlands | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIAASGRLDRK* |
| Ga0153916_102960803 | 3300012964 | Freshwater Wetlands | MNKILFIVGLCIALAAAALLFLSIIESGVAAVIGILGIGLIGASSVDRKSSGCK* |
| Ga0153916_105995092 | 3300012964 | Freshwater Wetlands | MNKILFIVGLGIALAAAALLFLNIIESGVAAMIGILGIGLIAASHVDRKSNGYK* |
| Ga0153916_107834781 | 3300012964 | Freshwater Wetlands | MNKILFIVGLCIALAAGVFLFLNIIESGVAAMIGILGIGLIGASHIDRKSSSRK* |
| Ga0153916_122986001 | 3300012964 | Freshwater Wetlands | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIGASSVDRKSSGCR* |
| Ga0153916_132384491 | 3300012964 | Freshwater Wetlands | MNKILFIAGLCIALAAAALLFLDVLESGVAALIGILGIGLIATSGRLDR |
| Ga0163202_10048541 | 3300013086 | Freshwater | MNKILFIVGLCIALAAAALLFLDLIESGVAAVIGILGIGLIAASGRL* |
| Ga0172380_100218795 | 3300014205 | Landfill Leachate | MHKILFLAGLCITLTSAALLFLGILEPGLAALVGIVGIGLIAASGMSNIKRL* |
| Ga0210112_11116422 | 3300025563 | Natural And Restored Wetlands | MNKILFTVGLCIALAAAALLFLNIIESGVAALIGILGIGLIGASGIDRKSSGGE |
| Ga0209201_100006114 | 3300025708 | Anaerobic Digestor Sludge | MNIALFLAGLCIALTAAALLFFDIIEPGLAAVIGIVGIGLIGASGMSHIRRL |
| Ga0208197_10495501 | 3300025720 | Anaerobic Digestor Sludge | MHKILFIAGLGIALTSSALLFFGIIEPGVAAMVGILGIGLIGMSHIKRM |
| Ga0208459_10304464 | 3300025748 | Anaerobic Digestor Sludge | MSIALFLAGLCIALTAAALLFFDIIEPGLAAVIGIVGIGLIGASGMSHIRRL |
| Ga0209200_10089904 | 3300025784 | Anaerobic Digestor Sludge | MNKILFLVGLCIALTSAALLFFGLIEPGPAAVIGIVGIGLIGASGMSHIRRL |
| Ga0209096_12172432 | 3300025859 | Anaerobic Digestor Sludge | MNRILFITGLCIALMAAALLFFSIIEPGVAAIIGILGIGLIAASGMS |
| Ga0210077_10621452 | 3300025952 | Natural And Restored Wetlands | MNKILFIVGLCIALVAAALLFLNIIESGVAAVIGILGIGLIGASGSSKIKRFK |
| Ga0209269_100132815 | 3300027051 | Enrichment Culture | MREVLGLCIALAAAALLFLNIIESGVAAMIGIPGIGLIVASGISKIKRL |
| Ga0209269_10028815 | 3300027051 | Enrichment Culture | MNKILFIIGLCIALTAAALLFLNIIESGVAAVIGILGIGLIAASGRL |
| Ga0209269_10064603 | 3300027051 | Enrichment Culture | MNKILFIVGLCIALAAAALLFLDIIESGVAAMIGILGIGLIAASSVDRKSSGCK |
| Ga0209269_10109622 | 3300027051 | Enrichment Culture | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIAASGRSKPSGCK |
| Ga0209269_10253713 | 3300027051 | Enrichment Culture | NKPLFIAAVCIAVAAASLLFLNIIESGIAAVIGILGIGLIALSGRL |
| Ga0209269_10259582 | 3300027051 | Enrichment Culture | MNKTVLGLFLFIVGLCIALAAAALLFLHIIESGVAAMIGILGIGLIGAAGAVFASRS |
| Ga0209269_10406091 | 3300027051 | Enrichment Culture | MNKPLVIAGVCIAVAAASLLFLNIIESGIAAVIGILGIGLI |
| Ga0209269_10413202 | 3300027051 | Enrichment Culture | MNKILFIVGLCIALAAASLLFLNIIESGVAAVIGILGIGLIAASGRV |
| Ga0209269_10664212 | 3300027051 | Enrichment Culture | MNKILFIVGLCIALAAASLLFLSIIESGVAAVIGILGIGLIGASSVDR |
| Ga0209373_103768512 | 3300027796 | Freshwater | MNIKLFIPGLLIVAIAATLLLLNVIESGVAAAIGILGIGLI |
| Ga0209293_100464623 | 3300027877 | Wetland | MNKILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIAVSGRL |
| Ga0209293_102878792 | 3300027877 | Wetland | MNKILFIVGLCIALAAAALLFFNILESGVAALIGILGIGLIAVSGRL |
| Ga0209450_101227252 | 3300027885 | Freshwater Lake Sediment | VNKILCIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSHADRKTSGCN |
| Ga0209450_108395852 | 3300027885 | Freshwater Lake Sediment | MNKILFMVGLCIALGAVALLFLDIIESGAAAMIGIIGIGLISASGISNIKRL |
| Ga0209254_101049921 | 3300027897 | Freshwater Lake Sediment | MHKILFLAGLCIALTSAALLFFGIIEPGVAAMIGIVGIGLIAASGMSNIKRL |
| Ga0209668_103821021 | 3300027899 | Freshwater Lake Sediment | MNKILFIAGLCIALASAALLFFDIIESGVAAVIGILGIGLIAASGMSKIKRL |
| Ga0209668_107805042 | 3300027899 | Freshwater Lake Sediment | MNLLRGTHMNKILFIVGLCIALAAAALLFLNIIQSGVAAMIGILGIGLIGASHVDRKSSGCK |
| Ga0209253_100230489 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALGAAALLFLDIIESGVAAMIGIIGIGLIGASGISNIKRL |
| Ga0209253_100679067 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASHVDRKSSGCK |
| Ga0209253_100727132 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIAASGGSKIKRL |
| Ga0209253_101851621 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIATSGRM |
| Ga0209253_101851623 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALAAAGFLFLNIIESGVAAVIGILGIGLIATSGRL |
| Ga0209253_110216942 | 3300027900 | Freshwater Lake Sediment | MNKILFIVGLCIALAAAALHLFNIIESGVAAMIGILGIGLIAVSGRLSPRCDLPA |
| (restricted) Ga0255343_10827832 | 3300028561 | Wastewater | MNKILFTIGLFIALGAAALLFLHIIESGVAAVIGILGIGVIAVSGQLKGNG |
| Ga0302242_10622732 | 3300028634 | Activated Sludge | APHMNKILFTIGLFIALGAAALLFLHIIESGVAAVIGILGIGVIAVSGQLKGNG |
| Ga0272443_100270314 | 3300028883 | Marine Sediment | MNKLLFIVGLCIALSAAALLFFGIIESGVAALIGILGIGLIGAAGAISASRS |
| Ga0307380_101254064 | 3300031539 | Soil | MTTLKGLAMNIILFFIGLAICLTAAGLLVLDVIESGVAALIGIVGIGLIGSSAIQRSQK |
| Ga0315542_10075006 | 3300031552 | Salt Marsh Sediment | MLLSGLIIAVSAALLLFVGAIASGPAAVIGIVGIGLIGASAPLRRRP |
| Ga0307379_100555623 | 3300031565 | Soil | MNKILFLILFIGGLCIALSAATLLFFGIIESGVAAMIGIVGIVLISASGISNIKRL |
| Ga0307378_105335551 | 3300031566 | Soil | MFINKTLFIIGLTICVTAAGLLLLNVIESGVAAAIGILGIGLIASSRKGK |
| Ga0315297_109522322 | 3300031873 | Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIGASGRCKSSGCK |
| Ga0315278_102795074 | 3300031997 | Sediment | MNKILFIVGLCIALAAAVLLLLNIIESGVAAVIGILGIGLIGASGRCKSSGCK |
| Ga0315284_107323571 | 3300032053 | Sediment | MNKILFIVGLSIALVAAARLFLNIIESGVAAVIGILGIGMIAASGISKIKRL |
| Ga0315284_115548752 | 3300032053 | Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASGRCKSSGCK |
| Ga0315277_101311375 | 3300032118 | Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAVIGILGIGLIGASGRL |
| Ga0315277_106367131 | 3300032118 | Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASS |
| Ga0315277_113977553 | 3300032118 | Sediment | KPMNNILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASSISKIKRL |
| Ga0315273_123909912 | 3300032516 | Sediment | MNKILFIVGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASSISKIKRL |
| Ga0316605_113195981 | 3300033408 | Soil | MNKILFIGGLCIALAAAALLLLNIIESGVAAMIGILGIGLIAVSGSGKFSLS |
| Ga0316605_119096562 | 3300033408 | Soil | MKKILFIVGLCIALTAAALLFLNIIESGVAAVIGILGIGLIGASHADRKSSGCK |
| Ga0316603_101535926 | 3300033413 | Soil | VNIILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSLADRKSSGCNER |
| Ga0316603_110115791 | 3300033413 | Soil | LNKILFIAGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGISNIKRL |
| Ga0316603_111748282 | 3300033413 | Soil | MNRILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIAVSGRL |
| Ga0316619_109156441 | 3300033414 | Soil | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGISNIKRL |
| Ga0316619_114720711 | 3300033414 | Soil | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGMSNSRRL |
| Ga0316619_116700062 | 3300033414 | Soil | MNKILFIAGLCIALGAAGLLLLNIIESGVAAVIGILGIGLIATSGRL |
| Ga0316601_1002767845 | 3300033419 | Soil | VNKILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGASGISNIKRL |
| Ga0316601_1008573362 | 3300033419 | Soil | MNKILFIAGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGVSNVRRL |
| Ga0316601_1025425722 | 3300033419 | Soil | MNKILFIAGLCIALGAAGLLFLNIIESGVAAVIGILGIGLIATSGRL |
| Ga0316613_111562131 | 3300033434 | Soil | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGTSHADRKSSG |
| Ga0316620_124772511 | 3300033480 | Soil | MNKILFIVGLCIALAAAALLFLNIIESGVAAIIGILGIGLFAASGRFNNF |
| Ga0316629_103402251 | 3300033483 | Soil | STYVNKILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSHADRKSSGCN |
| Ga0316626_104504733 | 3300033485 | Soil | MKKILFIVGLCIALTAAALLFLNIIESGVAAVIGILGIGLIGASHADRKSGGCK |
| Ga0316624_110525861 | 3300033486 | Soil | MIKILFIVGLCIALAAAVLLFLNIIESGVAAMIGILGIGLIGASSVDRKSSGCK |
| Ga0316630_100985972 | 3300033487 | Soil | MNKILFIAGLCIALGAAALLFFDIIESGVAAMIGILGIGLIGASGLSNIKRL |
| Ga0316630_109502232 | 3300033487 | Soil | MHMNKILFIVGLCIALSAVTLLFLDIIESGVAAMIGIIGIGLIGASGISNIKRL |
| Ga0316621_104578362 | 3300033488 | Soil | MHMNKILFIVGLCIALSAVTLLFLDIIESGFAAMIGIIGIGLIGASGISNIKRL |
| Ga0316621_107505851 | 3300033488 | Soil | LFIVGLCIALAAAALLFLNIIESGVAAIIGILGIGLFAASGRFNNF |
| Ga0316621_114103112 | 3300033488 | Soil | VNKILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSHADRKSSGCNE |
| Ga0316631_103189231 | 3300033493 | Soil | KILFIVGLCIALAAAALLFLNILESGVAALIGIIGIGLIAVSGRL |
| Ga0316616_1008449691 | 3300033521 | Soil | MNKILFIVGLCIALGAAALLFFDIIESGVAAMIGILGIGL |
| Ga0316616_1046984711 | 3300033521 | Soil | MNRILFIGGLCIALAAAALLVFNIIESGVAAMIGILGIGLIGASGISKIKRL |
| Ga0316617_1001929081 | 3300033557 | Soil | VNKILFIAGLCIALAAAALLFLNIIESGVAAMIGILGIGLIGTSLADRKSSGCNERVECYQRDWIIFL |
| Ga0334965_0038973_1719_1877 | 3300033991 | Sediment | MHKILFLAGLCIALTSAALLFFGIIEPGVAAMIGIVGIGLIAASGMSHIKRL |
| ⦗Top⦘ |