| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001085 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054694 | Ga0002401 |
| Sample Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5417318 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | El Dorado National Forest, Georgetown, California, USA | |||||||
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016972 | Metagenome / Metatranscriptome | 243 | Y |
| F061214 | Metagenome / Metatranscriptome | 132 | Y |
| F068062 | Metagenome / Metatranscriptome | 125 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12187J13240_100369 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 943 | Open in IMG/M |
| JGI12187J13240_100613 | Not Available | 697 | Open in IMG/M |
| JGI12187J13240_101033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12187J13240_100369 | JGI12187J13240_1003691 | F061214 | LSVISARCRLVNGFAKLTNISLALKETPMNGGPTYEGPKVAEYLGR* |
| JGI12187J13240_100613 | JGI12187J13240_1006131 | F016972 | VRLNPLTDAIPVVNLYLTIHEFDKISFGAKTSRYGPYGLGY |
| JGI12187J13240_101033 | JGI12187J13240_1010333 | F068062 | GLKEAAAATCQRNKDERADEIKPNSARHPRRLVEFI* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |