


| Basic Information | |
|---|---|
| Family ID | F068062 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PRFALRGLKKSAAATRQRDKDEGADEIQTNSARHPRTFNEFI |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.80 % |
| % of genes from short scaffolds (< 2000 bps) | 90.40 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF09917 | DUF2147 | 21.60 |
| PF03797 | Autotransporter | 8.00 |
| PF04773 | FecR | 3.20 |
| PF13432 | TPR_16 | 3.20 |
| PF02666 | PS_Dcarbxylase | 1.60 |
| PF01925 | TauE | 0.80 |
| PF13505 | OMP_b-brl | 0.80 |
| PF00005 | ABC_tran | 0.80 |
| PF13936 | HTH_38 | 0.80 |
| PF06240 | COXG | 0.80 |
| PF13924 | Lipocalin_5 | 0.80 |
| PF05598 | DUF772 | 0.80 |
| PF12680 | SnoaL_2 | 0.80 |
| PF00440 | TetR_N | 0.80 |
| PF03734 | YkuD | 0.80 |
| PF02518 | HATPase_c | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 1.60 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.20 % |
| Unclassified | root | N/A | 4.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_13322382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1026 | Open in IMG/M |
| 3300000956|JGI10216J12902_114900739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300001085|JGI12187J13240_101033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300001418|JGI20188J14859_1004073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1993 | Open in IMG/M |
| 3300001545|JGI12630J15595_10112508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300001593|JGI12635J15846_10346112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300002568|C688J35102_120820326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus | 1687 | Open in IMG/M |
| 3300003369|JGI24140J50213_10128925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 820 | Open in IMG/M |
| 3300005339|Ga0070660_100563995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 950 | Open in IMG/M |
| 3300005339|Ga0070660_100783517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300005355|Ga0070671_102038573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005356|Ga0070674_100144808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1787 | Open in IMG/M |
| 3300005456|Ga0070678_100470528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
| 3300005518|Ga0070699_100903373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300005539|Ga0068853_100850258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300005541|Ga0070733_10466260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 844 | Open in IMG/M |
| 3300005548|Ga0070665_101339425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 725 | Open in IMG/M |
| 3300005576|Ga0066708_10404637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 876 | Open in IMG/M |
| 3300006173|Ga0070716_100350318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1045 | Open in IMG/M |
| 3300006173|Ga0070716_101514409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300006175|Ga0070712_100244640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1430 | Open in IMG/M |
| 3300006186|Ga0075369_10310841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 736 | Open in IMG/M |
| 3300006914|Ga0075436_100233021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300006948|Ga0099826_10548357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300006950|Ga0075524_10528323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300007258|Ga0099793_10271804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
| 3300007265|Ga0099794_10222966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → Nitrosospira multiformis | 969 | Open in IMG/M |
| 3300007265|Ga0099794_10284494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300009089|Ga0099828_11274064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 651 | Open in IMG/M |
| 3300009090|Ga0099827_10687165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300009148|Ga0105243_12835574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300009174|Ga0105241_11102525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 748 | Open in IMG/M |
| 3300009174|Ga0105241_11207503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 717 | Open in IMG/M |
| 3300009545|Ga0105237_11774762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 624 | Open in IMG/M |
| 3300009553|Ga0105249_10712588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1064 | Open in IMG/M |
| 3300009650|Ga0105857_1134534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 684 | Open in IMG/M |
| 3300009709|Ga0116227_10892832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300010043|Ga0126380_11881944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300010046|Ga0126384_11611065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300010359|Ga0126376_13191959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300010361|Ga0126378_13332502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300010396|Ga0134126_11055282 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010858|Ga0126345_1222290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300011270|Ga0137391_11139390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300011444|Ga0137463_1063780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1378 | Open in IMG/M |
| 3300012096|Ga0137389_10655750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 902 | Open in IMG/M |
| 3300012096|Ga0137389_10841816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 787 | Open in IMG/M |
| 3300012189|Ga0137388_10184569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1871 | Open in IMG/M |
| 3300012189|Ga0137388_10235226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1663 | Open in IMG/M |
| 3300012189|Ga0137388_11117895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 725 | Open in IMG/M |
| 3300012198|Ga0137364_11100999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300012203|Ga0137399_10950409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300012205|Ga0137362_10431647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1141 | Open in IMG/M |
| 3300012350|Ga0137372_10417707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300012351|Ga0137386_10970571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300012359|Ga0137385_10750942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300012363|Ga0137390_10591225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1078 | Open in IMG/M |
| 3300012363|Ga0137390_10687967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 986 | Open in IMG/M |
| 3300012582|Ga0137358_10115606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1821 | Open in IMG/M |
| 3300012683|Ga0137398_10968027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300012893|Ga0157284_10070933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300012918|Ga0137396_10490078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300012923|Ga0137359_11540770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012924|Ga0137413_11522228 | Not Available | 544 | Open in IMG/M |
| 3300012929|Ga0137404_10019459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4873 | Open in IMG/M |
| 3300012930|Ga0137407_11619376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 617 | Open in IMG/M |
| 3300012955|Ga0164298_11017318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300012960|Ga0164301_11333431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 583 | Open in IMG/M |
| 3300012961|Ga0164302_10640253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 777 | Open in IMG/M |
| 3300012961|Ga0164302_10821125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300012985|Ga0164308_10324275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1233 | Open in IMG/M |
| 3300012988|Ga0164306_10681506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300012998|Ga0157362_1254149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300013296|Ga0157374_12084958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300014325|Ga0163163_11569745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300014326|Ga0157380_12343169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300014657|Ga0181522_10276549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 995 | Open in IMG/M |
| 3300015197|Ga0167638_1034383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1150 | Open in IMG/M |
| 3300015200|Ga0173480_10239693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300015242|Ga0137412_10569377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 860 | Open in IMG/M |
| 3300015372|Ga0132256_101263643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 851 | Open in IMG/M |
| 3300015374|Ga0132255_100295341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2330 | Open in IMG/M |
| 3300017975|Ga0187782_10278270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1261 | Open in IMG/M |
| 3300019789|Ga0137408_1261749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300019883|Ga0193725_1110823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300020580|Ga0210403_10123682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2107 | Open in IMG/M |
| 3300021171|Ga0210405_10142260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1899 | Open in IMG/M |
| 3300021180|Ga0210396_10441451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1142 | Open in IMG/M |
| 3300021403|Ga0210397_11156626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300021404|Ga0210389_10073957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2613 | Open in IMG/M |
| 3300025505|Ga0207929_1055552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 751 | Open in IMG/M |
| 3300025553|Ga0208080_1013416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3049 | Open in IMG/M |
| 3300025553|Ga0208080_1026761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1820 | Open in IMG/M |
| 3300025904|Ga0207647_10162524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300025923|Ga0207681_11622976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300025931|Ga0207644_10619575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300025961|Ga0207712_11905326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300026118|Ga0207675_100209923 | Not Available | 1872 | Open in IMG/M |
| 3300027039|Ga0207855_1027512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 771 | Open in IMG/M |
| 3300027678|Ga0209011_1144237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 672 | Open in IMG/M |
| 3300027738|Ga0208989_10014456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2704 | Open in IMG/M |
| 3300027787|Ga0209074_10537056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300027902|Ga0209048_10138304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1829 | Open in IMG/M |
| 3300027903|Ga0209488_10729171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 708 | Open in IMG/M |
| 3300027903|Ga0209488_10845902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 645 | Open in IMG/M |
| 3300028379|Ga0268266_10993407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 812 | Open in IMG/M |
| 3300028906|Ga0308309_11831273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300030739|Ga0302311_10132252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1969 | Open in IMG/M |
| 3300030943|Ga0311366_11628559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300031028|Ga0302180_10095840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1707 | Open in IMG/M |
| 3300031231|Ga0170824_114234518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300031366|Ga0307506_10079355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300031681|Ga0318572_10160724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1301 | Open in IMG/M |
| 3300031708|Ga0310686_109782324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 983 | Open in IMG/M |
| 3300031708|Ga0310686_117336852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300031788|Ga0302319_10059981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5961 | Open in IMG/M |
| 3300031946|Ga0310910_11401068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300031954|Ga0306926_12168281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300032896|Ga0335075_10943414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 784 | Open in IMG/M |
| 3300032955|Ga0335076_10169344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 2095 | Open in IMG/M |
| 3300034060|Ga0334983_0528344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 656 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.60% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.80% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 0.80% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001085 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012998 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM3 | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_133223821 | 3300000550 | Soil | RLAPPWLALCLEESTATACQRNKDKGADEIQTNSTRHPRKFGEFI* |
| JGI10216J12902_1149007393 | 3300000956 | Soil | KKSATAARQRDKDDGADEIRANSARHARKFDEFI* |
| JGI12187J13240_1010333 | 3300001085 | Forest Soil | GLKEAAAATCQRNKDERADEIKPNSARHPRRLVEFI* |
| JGI20188J14859_10040734 | 3300001418 | Arctic Peat Soil | GLKKSAAATRQRDKDQGADEIPTNSARHPRNFKEFT* |
| JGI12630J15595_101125081 | 3300001545 | Forest Soil | KKSAAAARQRDKDEGADEIEANSARHPRRFDEFI* |
| JGI12635J15846_103461121 | 3300001593 | Forest Soil | GLKKSATAARQRNKDEGADEIQTNSARHARNFNEFI* |
| C688J35102_1208203261 | 3300002568 | Soil | ALLGLKESAAASRQRDKDEGADEIQTNSARHPRRFREFI* |
| JGI24140J50213_101289251 | 3300003369 | Arctic Peat Soil | LQACQFGLGPPRFALSGLKKSASATRQRDKDEGADQNQTNSARHPRTFNQFI* |
| Ga0070660_1005639954 | 3300005339 | Corn Rhizosphere | GPPRFALRGLKKSATATRQRDKDEGADEIQTNSARHPRTFNEFI* |
| Ga0070660_1007835172 | 3300005339 | Corn Rhizosphere | GPPRFALRGLKKSATATRQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0070671_1020385731 | 3300005355 | Switchgrass Rhizosphere | FQACDLGLGPPRFALRGLKKAAAATCQRNKDKGADQDQTNSVRHPRTLVEFI* |
| Ga0070674_1001448084 | 3300005356 | Miscanthus Rhizosphere | GPPRFALGLEKATAATRQRDKDDGADEIKTNSMHHGRRFDEFI* |
| Ga0070678_1004705281 | 3300005456 | Miscanthus Rhizosphere | GFGLGPPRFALGLEKATAATRQRDKDDGADEIKTNSMHHGRRFGEFI* |
| Ga0070699_1009033732 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTPGFTLGELKKSATAARQRDKDDGADKVQTNSARHPRKFDEFI* |
| Ga0068853_1008502581 | 3300005539 | Corn Rhizosphere | FGLGPPRFALGLEKATAATRQRDKDDGADEIKTNSMHHGRRFGEFI* |
| Ga0070733_104662601 | 3300005541 | Surface Soil | GPPWPAFLGLKKSAAATRQRDKDQGADEIPANSARHPRNFKEFT* |
| Ga0070665_1013394253 | 3300005548 | Switchgrass Rhizosphere | GPPRFALGGLKSAAATRQGDKDEGADEIQTNSARHRRTFGEFI* |
| Ga0066708_104046371 | 3300005576 | Soil | KEPAAAACQRDKDEGADEVQTNSTRHPRNFGEFI* |
| Ga0070716_1003503181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RFALGGLKKSAAAARQRNKDEGADEIQTNSARHGGTFDEFI* |
| Ga0070716_1015144091 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LRGLKKSTAAARQRDKDEGADEIQTNSARHPRRFDEFI* |
| Ga0070712_1002446403 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLQARDFSLGPPRLTLFEKEATATRQRDKDEGADEIPTNSVRHAQNFNEFI* |
| Ga0075369_103108411 | 3300006186 | Populus Endosphere | GLEKAASATRKRNKDDGADEIQTNSARHARTLGEFT* |
| Ga0075436_1002330213 | 3300006914 | Populus Rhizosphere | LGLEETTTAACQRSKDEGADEIQANSARHLHTFGDFI* |
| Ga0099826_105483571 | 3300006948 | Root Nodules | GPPRFTFGLEKAASATRKRNKDDGADEIQTNSARHARTFDEFT* |
| Ga0075524_105283231 | 3300006950 | Arctic Peat Soil | LKKSAAAARQRDKDEGADEIQTNSARHPRTFNEFI* |
| Ga0099793_102718043 | 3300007258 | Vadose Zone Soil | LGPPRFALLGLKKSATATRQRDKDEAADQIQTNSARHPRTFDEFI* |
| Ga0099794_102229661 | 3300007265 | Vadose Zone Soil | AGLQACDFGLGPPRFTLRGLKKSAAATRQRDKDEGADEVQANSGRHPRTFDQFI* |
| Ga0099794_102844941 | 3300007265 | Vadose Zone Soil | AGDFGLGPPRFALRGLKKSATATRQRNKDEGADEIQTNSARHPRTFNEFI* |
| Ga0099828_112740643 | 3300009089 | Vadose Zone Soil | DFGLGPPRFALRGLKESAAAARERDKDEGADEVQTNSARHPRTFNEFI* |
| Ga0099827_106871653 | 3300009090 | Vadose Zone Soil | GLGTPRFALGGLKKSATAARQRNKDKGADEIQTNSARHPRTFDEFI* |
| Ga0105243_128355742 | 3300009148 | Miscanthus Rhizosphere | HRAGFETCDFCLGTPWLTFLGLKQTASATRKRYKDDGADEIQTNSARHSRKVVEMF* |
| Ga0105241_111025252 | 3300009174 | Corn Rhizosphere | FGLEKAATATRERNEDDGADEIQTNSARHGRTFGEFT* |
| Ga0105241_112075032 | 3300009174 | Corn Rhizosphere | GLQACQFGLGPPRFALRGLKKSAATTRKRNKDEGADEIQTNSTRHARKFDEFI* |
| Ga0105237_117747623 | 3300009545 | Corn Rhizosphere | GPPRLTLGGLKQSAPTASQRNKDEGADEIQTNSTHHPGTFGEFI* |
| Ga0105249_107125881 | 3300009553 | Switchgrass Rhizosphere | PWFPLGLEKSTAAACQRNKDKGADEIQTNSTRHPRKFGEFI* |
| Ga0105857_11345343 | 3300009650 | Permafrost Soil | PWFTLLGLKKSAAAARQRNKDEGADEIQANSARHPRNFNEFI* |
| Ga0116227_108928321 | 3300009709 | Host-Associated | GFQACDFCLGPPRLALLGLKQSATATRQRDKDKGADEIQTNSARHPRNIGQYI* |
| Ga0126380_118819442 | 3300010043 | Tropical Forest Soil | LEESATATRQRDKDDGADDIQTNSTRHPRTFGELP* |
| Ga0126384_116110651 | 3300010046 | Tropical Forest Soil | LRGLKESAAATCKRDEDERADKIQTNSARHRATFDDFI* |
| Ga0126376_131919591 | 3300010359 | Tropical Forest Soil | AFGLEKPTATTCQRNKDKGADEIQTNSTRHARKFNEFI* |
| Ga0126378_133325023 | 3300010361 | Tropical Forest Soil | GELKKSAAATRQRDKDDGADEVQTNSTRHPHTFDELP* |
| Ga0134126_110552821 | 3300010396 | Terrestrial Soil | LGSPRCALLGLKKPATATRKRNEDQGADEIQTNSARHPRNFNEFI* |
| Ga0126345_12222901 | 3300010858 | Boreal Forest Soil | LRGLKQTATTTRQRNKDEGADEIQTNSARHPRMFNEYI* |
| Ga0137391_111393901 | 3300011270 | Vadose Zone Soil | RRLEKSAAAARQRDKDEGADQIQTNSARHPRRFDQFI* |
| Ga0137463_10637803 | 3300011444 | Soil | DLGLGPPWFALGGLKKSAAAARQRNEDEGADEIQTNSARHGGTFDEFI* |
| Ga0137389_106557503 | 3300012096 | Vadose Zone Soil | GDFGLGPPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHSRTFDEFI* |
| Ga0137389_108418161 | 3300012096 | Vadose Zone Soil | GDFGLGPPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0137388_101845691 | 3300012189 | Vadose Zone Soil | PRFALRGLKKSATATRQRDKDERADEIQTNSARHPRRIDEFL* |
| Ga0137388_102352261 | 3300012189 | Vadose Zone Soil | PRFALRGLKKSTAAARQRDKDEGADEIQTNSARHSRTFDEFI* |
| Ga0137388_111178954 | 3300012189 | Vadose Zone Soil | FALRGLKKSTAAARQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0137364_111009992 | 3300012198 | Vadose Zone Soil | GLGPPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0137399_109504092 | 3300012203 | Vadose Zone Soil | DFGLGPPRFALRGLKKSAAATRQRDKDEGADEIQTNSARHPRTFNEFI* |
| Ga0137362_104316473 | 3300012205 | Vadose Zone Soil | GLGPPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHPRRFDEFI* |
| Ga0137372_104177071 | 3300012350 | Vadose Zone Soil | CEFGLSPPRFALGGLKKSAAATRQRDKDEGADQIQTNSTRHGGTFDEFI* |
| Ga0137386_109705711 | 3300012351 | Vadose Zone Soil | GFALGGLKETATAARQRDKDDGADEIQTNSARHPRRFGDFT* |
| Ga0137385_107509424 | 3300012359 | Vadose Zone Soil | GPPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHPRRFDEFI* |
| Ga0137390_105912253 | 3300012363 | Vadose Zone Soil | PRFALRGLKKSAAATRQRDKDEGADEIQTNSARHPRTFNEFI* |
| Ga0137390_106879671 | 3300012363 | Vadose Zone Soil | PPRFALRGLKKSTAAARQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0137358_101156061 | 3300012582 | Vadose Zone Soil | PPRFALLGLKKSAPTTRQRDKDEGADEIQANSARHPRNFNEFI* |
| Ga0137358_104928353 | 3300012582 | Vadose Zone Soil | AFLDRAGFQTCHLGLGPPRLALGGLKKSAAAARQRNKDEGADEIQTNSARHRGTFDEFI* |
| Ga0137398_109680273 | 3300012683 | Vadose Zone Soil | ACDFGLGPPRFTLRGLKKSAAATRQRDKDEGADEVQANSARHPRTFVQFI* |
| Ga0157284_100709332 | 3300012893 | Soil | GPPWFALGGLKKSASAARQRNKDEGADEIQTNSARHARNFNEFI* |
| Ga0157283_101850872 | 3300012907 | Soil | DRSGLQACNLGLGPPRFTLGGLKQSAAATRQGDKDEGADEIQTNSARHARNFNEFI* |
| Ga0137396_104900783 | 3300012918 | Vadose Zone Soil | LGPPRFALRGLKKSAAATRQRNKDEGADEIQTNSARHPRTFNEFI* |
| Ga0137359_108431382 | 3300012923 | Vadose Zone Soil | VLLDGAGLQAGDFGLGPPRFALRGLKKSATATRQRDKDEAADQIQTNSARHPRRFDEFI* |
| Ga0137359_115407703 | 3300012923 | Vadose Zone Soil | GLQARDFGLGPPRFTLRGLKKSAAATRQRDKDEGAEEAQANSARHPRRFDQFI* |
| Ga0137413_115222281 | 3300012924 | Vadose Zone Soil | LRGLKKSATATHQRDKDQGADQIQTNSARHPRTFNEFI* |
| Ga0137416_122414412 | 3300012927 | Vadose Zone Soil | FLDRTRLQACDLGLGPPRFALGGQKSATATRQGAKDEGADEIQTNSTRHRRRFGEFI* |
| Ga0137404_100194591 | 3300012929 | Vadose Zone Soil | LGPPRLTFFGKKSATAACKRDKDEGADEIQTNSARHPRNFNEFI* |
| Ga0137407_116193762 | 3300012930 | Vadose Zone Soil | LLGLKKAAAATCQRDKDEAADQIQANAARHPRNFNEFI* |
| Ga0164298_110173181 | 3300012955 | Soil | LRGLKKSTAAARQRDKDEGADEIQTNSARHSRTFDEFI* |
| Ga0164301_113334313 | 3300012960 | Soil | CHLVHGPPGFAHGALKKSAAAARQRNKDEGAYEIQTNSARHGGTFDEFI* |
| Ga0164302_106402533 | 3300012961 | Soil | GLGPPRFALGLEKAAAATRQRDKDDGADEIQTNSTRHGRRFGEFT* |
| Ga0164302_108211253 | 3300012961 | Soil | SGFQTGDLGLGPPRLALGGLEKSAAAACQRNKDEGADEIQTNSARHPRRFGEFI* |
| Ga0164308_103242752 | 3300012985 | Soil | RGLKKSTAAARQRDKDEGADEIQTNSARHPRTFDEFI* |
| Ga0164306_106815061 | 3300012988 | Soil | GLQASEFGLGPPRFALGGHKTAPATRQRSKDDGADQIQTNSARHPRNFDQFI* |
| Ga0157362_12541491 | 3300012998 | Fungus Garden | LEKTTAATCQRNKDKGADEIQTNSTRHPRKFGEFI* |
| Ga0157374_120849583 | 3300013296 | Miscanthus Rhizosphere | ALRGLKKAAATTCQRNKDKGADQDQTNSVRHPRTLVEFI* |
| Ga0163163_115697451 | 3300014325 | Switchgrass Rhizosphere | LGLGPPWFALGGLKKSAAAARQRNKDEGADEIQTNSARHGGTFDEFI* |
| Ga0157380_123431693 | 3300014326 | Switchgrass Rhizosphere | FALRELKKSAAAARQRDKDEGADEIQTNSARHPRTFNEFI* |
| Ga0181522_102765491 | 3300014657 | Bog | PRLALFGKKTATATRERYKDEGADEIQTNSARHAENFNEFI* |
| Ga0167638_10343831 | 3300015197 | Glacier Forefield Soil | PPRFALGRLKKSATATRQRDKDEGADQIETNSARHPRTFDQFI* |
| Ga0173480_102396931 | 3300015200 | Soil | PPWFALGGLKKPAAAARQRNKDEGADEIQTNSARHGGTFDEFI* |
| Ga0137412_105693773 | 3300015242 | Vadose Zone Soil | DRAGFQARDLGLGPPRFPLRGLKKSATATHQRDKDQGADQIQTNSARHPRTFNEFI* |
| Ga0132256_1012636431 | 3300015372 | Arabidopsis Rhizosphere | CDLGLGSPRLPLGLEKSTAATRQRDKDEGADEIQTNSARHGGTFDEFI* |
| Ga0132255_1002953414 | 3300015374 | Arabidopsis Rhizosphere | LALGLEESTATACQRNKDKGADEIQTNSARHPRKFGEFI* |
| Ga0187782_102782703 | 3300017975 | Tropical Peatland | LGLEPSTTAACQRNKDDGADEIQTNSARHARTFDQFI |
| Ga0137408_12617491 | 3300019789 | Vadose Zone Soil | ISAACDFSLGPPRLTFFGKKSATAACKRDKDEGADEIQTNSARHPRNFNEFI |
| Ga0193725_11108232 | 3300019883 | Soil | HRAGLQARDFGLGPPWFALRGEKSAAAARQRDEDEGADEIQTNSARHPRRFDEFI |
| Ga0210403_101236824 | 3300020580 | Soil | GLKKSATATHQRDKDEGADEIQTNSARHPRNLNQFI |
| Ga0210405_101422604 | 3300021171 | Soil | LGPPWFALRGLKKSAAAASQRDKDEGADEIQTNSARHPCRFDEFI |
| Ga0210396_104414512 | 3300021180 | Soil | FFGKKSATAACKRDKDEGADEIQTNSARHPRNFNEFI |
| Ga0210397_111566263 | 3300021403 | Soil | GEKSAAATCQRNKDEAADQIPANAPRHPRRFNDFI |
| Ga0210389_100739575 | 3300021404 | Soil | LTLLGKKSAAATRQRYKDEGADEIPTNSARHAENFNEFI |
| Ga0207929_10555523 | 3300025505 | Arctic Peat Soil | GGLKKSAAAARQRDKDEGADEIQTNSARHPRRFDEFI |
| Ga0208080_10134163 | 3300025553 | Arctic Peat Soil | RFPLRGLKESAAAARQRDKDEGADQIQTNSARHPRTFDEFI |
| Ga0208080_10267614 | 3300025553 | Arctic Peat Soil | ALRGLKKSAAATRQRDKDEGADEIETNSARHPRTFNEFI |
| Ga0207647_101625243 | 3300025904 | Corn Rhizosphere | GPPRFALGSLKQTATATSKRHKDKGADEIQTNSTRHGAEVLRI |
| Ga0207681_116229762 | 3300025923 | Switchgrass Rhizosphere | GLEKAASATRKRNKDDGADEIQTNSARHARTFGEFT |
| Ga0207644_106195751 | 3300025931 | Switchgrass Rhizosphere | PPRFALGGLKSAAATRQGDKDEGADEIQTNSARHRRTFGEFI |
| Ga0207712_119053261 | 3300025961 | Switchgrass Rhizosphere | PWFPLGLEKSTAAACQRNKDKGADEIQTNSTRHPRKFGEFI |
| Ga0207675_1002099231 | 3300026118 | Switchgrass Rhizosphere | LGGLKSAAATRQGDKDEGADEIQTNSARHRRTFGEFI |
| Ga0207855_10275121 | 3300027039 | Tropical Forest Soil | GLEKSVAAACQRNKDEGADEIQTNSTRHPRTFDEFI |
| Ga0209011_11442371 | 3300027678 | Forest Soil | PPRFPLRGLKKSAAATRQRDKDQGADQIQTNSARHPRTFNEFI |
| Ga0208989_100144565 | 3300027738 | Forest Soil | RFAFLGLKKSTAASRQRDKDEGADEIQTNSARHPRTFGEFI |
| Ga0209074_105370561 | 3300027787 | Agricultural Soil | ALGLEESTPAAGQRNKDKGADEIQTNSTRHPRKFGQFI |
| Ga0209048_101383044 | 3300027902 | Freshwater Lake Sediment | PRLALRGLKKSAAAARQRDKDEEADEIQTNSARHPRRFDEFI |
| Ga0209488_107291711 | 3300027903 | Vadose Zone Soil | GPPRFALRGRKKSAAATRQRDKDQGADEIQTNSARHPGNFNEFI |
| Ga0209488_108459021 | 3300027903 | Vadose Zone Soil | PRFALRGLKKSTAAARQRDKDEGADEIQTNSAHHPRTFDEFI |
| Ga0268266_109934072 | 3300028379 | Switchgrass Rhizosphere | GGLKSAAATRQGDKDEGADEIQTNSARHRRTFGEFI |
| Ga0308309_118312731 | 3300028906 | Soil | GLKKSAAATRQRDKDDGADEIQTNSTRHPRTFGELP |
| Ga0302311_101322524 | 3300030739 | Palsa | FALLGLKQSATATRQRDEDEGADEIQTNSARHPRNIGQFI |
| Ga0311366_116285593 | 3300030943 | Fen | LKKAATATRQRDKDEGADEIQTNSARHSRRFGEFI |
| Ga0302180_100958401 | 3300031028 | Palsa | LGPPRFALLGLKISAAAARQRNKDEGADEIQTNSARHPRNFNEFI |
| Ga0170824_1142345181 | 3300031231 | Forest Soil | TARARRTEKKSAAATRKRDKDDRADEIQTNSARHRATFDDFI |
| Ga0307506_100793551 | 3300031366 | Soil | GLEKPTAAACQRNKDKGADEIQTNSTRHPRKFGEFI |
| Ga0318572_101607243 | 3300031681 | Soil | GLEKSVAAACQRNKDEGADEIQTNSTRHSRTFDEFI |
| Ga0310686_1097823243 | 3300031708 | Soil | LALLGLKKSATAARQRDKDEGADEIQTNSARHARNFNEFI |
| Ga0310686_1173368523 | 3300031708 | Soil | ALLGLKKSATAARQRDKDEGADEIQTNSARHTRNFNEFI |
| Ga0302319_100599811 | 3300031788 | Bog | GLGPPRFALRGLKESASAARERYKDEGADEIQTNSARHRRRFGEFI |
| Ga0310910_114010681 | 3300031946 | Soil | LKKSAAATGQRYEDDRADKIQTNSARHRATFDEFI |
| Ga0306926_121682812 | 3300031954 | Soil | ARDFGLGPPWLALGLEESTPATCQRNKDDGADEVQTNSARHPRKFDQFI |
| Ga0335075_109434143 | 3300032896 | Soil | GAPRLALGGLEKSAAATRQRDEDDGADEIQTNSTRHSRRFGELP |
| Ga0335076_101693441 | 3300032955 | Soil | ELGLGPPRLALSLEKSMTATRQRNKDEGADEIPTNSARHPRTFDDFA |
| Ga0334983_0528344_499_654 | 3300034060 | Freshwater | FQARRFGLGPPRFTFGLEKAASATRERNEDDGADEIQTNSARHARTFGEFT |
| ⦗Top⦘ |