


| Basic Information | |
|---|---|
| Taxon OID | 3300029448 Open in IMG/M |
| Scaffold ID | Ga0183755_1003488 Open in IMG/M |
| Source Dataset Name | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7860 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (18.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea: TARA_023 | |||||||
| Coordinates | Lat. (o) | 42.1735 | Long. (o) | 17.7252 | Alt. (m) | Depth (m) | 55 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039877 | Metagenome | 163 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0183755_100348813 | F039877 | GGA | MKQKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKNEEKKD |
| ⦗Top⦘ |