


| Basic Information | |
|---|---|
| Family ID | F039877 |
| Family Type | Metagenome |
| Number of Sequences | 163 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 34.97 % |
| % of genes near scaffold ends (potentially truncated) | 26.99 % |
| % of genes from short scaffolds (< 2000 bps) | 74.23 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.534 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.356 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.890 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 26.99 |
| PF13392 | HNH_3 | 14.11 |
| PF11753 | DUF3310 | 7.98 |
| PF01555 | N6_N4_Mtase | 6.75 |
| PF00145 | DNA_methylase | 6.13 |
| PF04466 | Terminase_3 | 5.52 |
| PF13455 | MUG113 | 1.84 |
| PF10544 | T5orf172 | 1.23 |
| PF06356 | DUF1064 | 1.23 |
| PF14550 | Peptidase_S78_2 | 1.23 |
| PF02195 | ParBc | 1.23 |
| PF08299 | Bac_DnaA_C | 1.23 |
| PF05766 | NinG | 1.23 |
| PF12705 | PDDEXK_1 | 0.61 |
| PF04860 | Phage_portal | 0.61 |
| PF03819 | MazG | 0.61 |
| PF11351 | GTA_holin_3TM | 0.61 |
| PF13884 | Peptidase_S74 | 0.61 |
| PF07463 | NUMOD4 | 0.61 |
| PF00303 | Thymidylat_synt | 0.61 |
| PF02018 | CBM_4_9 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.75 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.75 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.75 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 6.13 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 5.52 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.23 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.53 % |
| All Organisms | root | All Organisms | 48.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10052311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2029 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10125653 | Not Available | 997 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10160841 | Not Available | 807 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10002217 | Not Available | 11411 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10045903 | Not Available | 1941 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10077704 | Not Available | 1325 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10110786 | Not Available | 982 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1008375 | Not Available | 1443 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000368 | Not Available | 27955 | Open in IMG/M |
| 3300001450|JGI24006J15134_10021891 | All Organisms → Viruses → Predicted Viral | 2927 | Open in IMG/M |
| 3300001450|JGI24006J15134_10039917 | Not Available | 1992 | Open in IMG/M |
| 3300001450|JGI24006J15134_10075752 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300001450|JGI24006J15134_10087886 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300001460|JGI24003J15210_10034262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1824 | Open in IMG/M |
| 3300001460|JGI24003J15210_10044768 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300001460|JGI24003J15210_10055146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300001460|JGI24003J15210_10061901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300001460|JGI24003J15210_10062101 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300001460|JGI24003J15210_10098215 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 844 | Open in IMG/M |
| 3300001460|JGI24003J15210_10143464 | Not Available | 621 | Open in IMG/M |
| 3300001472|JGI24004J15324_10000712 | Not Available | 13338 | Open in IMG/M |
| 3300001472|JGI24004J15324_10035890 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
| 3300001472|JGI24004J15324_10056172 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300001472|JGI24004J15324_10094557 | Not Available | 780 | Open in IMG/M |
| 3300001946|GOS2244_1002329 | Not Available | 1126 | Open in IMG/M |
| 3300002482|JGI25127J35165_1007200 | All Organisms → Viruses → Predicted Viral | 2891 | Open in IMG/M |
| 3300003542|FS900DNA_10174910 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300005239|Ga0073579_1151947 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 915 | Open in IMG/M |
| 3300005239|Ga0073579_1169660 | Not Available | 25024 | Open in IMG/M |
| 3300005934|Ga0066377_10145479 | Not Available | 720 | Open in IMG/M |
| 3300005941|Ga0070743_10056492 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300006735|Ga0098038_1006187 | All Organisms → Viruses → Predicted Viral | 4855 | Open in IMG/M |
| 3300006735|Ga0098038_1013752 | All Organisms → Viruses → Predicted Viral | 3131 | Open in IMG/M |
| 3300006737|Ga0098037_1061955 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300006789|Ga0098054_1067658 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300006793|Ga0098055_1088009 | Not Available | 1218 | Open in IMG/M |
| 3300006793|Ga0098055_1261559 | Not Available | 650 | Open in IMG/M |
| 3300006802|Ga0070749_10006886 | All Organisms → Viruses | 7436 | Open in IMG/M |
| 3300006810|Ga0070754_10025806 | All Organisms → Viruses → Predicted Viral | 3354 | Open in IMG/M |
| 3300006916|Ga0070750_10038589 | All Organisms → Viruses → Predicted Viral | 2353 | Open in IMG/M |
| 3300006916|Ga0070750_10331880 | Not Available | 645 | Open in IMG/M |
| 3300006919|Ga0070746_10105454 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
| 3300006919|Ga0070746_10283250 | Not Available | 765 | Open in IMG/M |
| 3300006919|Ga0070746_10319820 | All Organisms → Viruses | 709 | Open in IMG/M |
| 3300006919|Ga0070746_10434845 | Not Available | 584 | Open in IMG/M |
| 3300006920|Ga0070748_1045302 | All Organisms → Viruses → Predicted Viral | 1762 | Open in IMG/M |
| 3300006920|Ga0070748_1140210 | Not Available | 903 | Open in IMG/M |
| 3300006921|Ga0098060_1184195 | Not Available | 573 | Open in IMG/M |
| 3300006924|Ga0098051_1060705 | Not Available | 1036 | Open in IMG/M |
| 3300006929|Ga0098036_1199413 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 608 | Open in IMG/M |
| 3300007276|Ga0070747_1129397 | Not Available | 916 | Open in IMG/M |
| 3300007276|Ga0070747_1173192 | Not Available | 769 | Open in IMG/M |
| 3300007276|Ga0070747_1308886 | Not Available | 543 | Open in IMG/M |
| 3300007558|Ga0102822_1058709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → Gramella forsetii → Gramella forsetii KT0803 | 910 | Open in IMG/M |
| 3300010148|Ga0098043_1164582 | Not Available | 623 | Open in IMG/M |
| 3300010150|Ga0098056_1116473 | Not Available | 909 | Open in IMG/M |
| 3300010150|Ga0098056_1182157 | Not Available | 704 | Open in IMG/M |
| 3300010392|Ga0118731_105952401 | Not Available | 627 | Open in IMG/M |
| 3300010430|Ga0118733_106422528 | Not Available | 614 | Open in IMG/M |
| 3300010430|Ga0118733_108565280 | Not Available | 528 | Open in IMG/M |
| 3300011253|Ga0151671_1015678 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300012936|Ga0163109_11007058 | Not Available | 608 | Open in IMG/M |
| 3300013010|Ga0129327_10917869 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 504 | Open in IMG/M |
| 3300017697|Ga0180120_10384472 | Not Available | 552 | Open in IMG/M |
| 3300017710|Ga0181403_1003387 | All Organisms → Viruses → Predicted Viral | 3561 | Open in IMG/M |
| 3300017713|Ga0181391_1018789 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
| 3300017714|Ga0181412_1005430 | All Organisms → Viruses → Predicted Viral | 4181 | Open in IMG/M |
| 3300017719|Ga0181390_1099118 | Not Available | 782 | Open in IMG/M |
| 3300017720|Ga0181383_1064106 | Not Available | 986 | Open in IMG/M |
| 3300017724|Ga0181388_1004337 | All Organisms → Viruses → Predicted Viral | 3937 | Open in IMG/M |
| 3300017726|Ga0181381_1047094 | Not Available | 949 | Open in IMG/M |
| 3300017727|Ga0181401_1161270 | All Organisms → Viruses | 542 | Open in IMG/M |
| 3300017731|Ga0181416_1046435 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300017735|Ga0181431_1015501 | All Organisms → Viruses → Predicted Viral | 1793 | Open in IMG/M |
| 3300017737|Ga0187218_1018491 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1832 | Open in IMG/M |
| 3300017738|Ga0181428_1077770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 774 | Open in IMG/M |
| 3300017739|Ga0181433_1011026 | All Organisms → Viruses → Predicted Viral | 2489 | Open in IMG/M |
| 3300017739|Ga0181433_1029437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → Votkovvirus S28C10 | 1435 | Open in IMG/M |
| 3300017739|Ga0181433_1060794 | Not Available | 950 | Open in IMG/M |
| 3300017743|Ga0181402_1051790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 1106 | Open in IMG/M |
| 3300017743|Ga0181402_1078513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 865 | Open in IMG/M |
| 3300017753|Ga0181407_1004432 | All Organisms → Viruses → Predicted Viral | 4222 | Open in IMG/M |
| 3300017755|Ga0181411_1026696 | Not Available | 1851 | Open in IMG/M |
| 3300017755|Ga0181411_1051668 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1266 | Open in IMG/M |
| 3300017755|Ga0181411_1234191 | Not Available | 509 | Open in IMG/M |
| 3300017757|Ga0181420_1136365 | Not Available | 738 | Open in IMG/M |
| 3300017759|Ga0181414_1039888 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300017762|Ga0181422_1014078 | Not Available | 2656 | Open in IMG/M |
| 3300017764|Ga0181385_1071976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 1066 | Open in IMG/M |
| 3300017772|Ga0181430_1012606 | All Organisms → Viruses → Predicted Viral | 2882 | Open in IMG/M |
| 3300017772|Ga0181430_1106954 | Not Available | 830 | Open in IMG/M |
| 3300017773|Ga0181386_1190749 | Not Available | 618 | Open in IMG/M |
| 3300017779|Ga0181395_1052804 | Not Available | 1338 | Open in IMG/M |
| 3300017781|Ga0181423_1082944 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1264 | Open in IMG/M |
| 3300017782|Ga0181380_1039125 | Not Available | 1722 | Open in IMG/M |
| 3300017782|Ga0181380_1063337 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300017786|Ga0181424_10022442 | All Organisms → Viruses → Predicted Viral | 2735 | Open in IMG/M |
| 3300018416|Ga0181553_10300551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300019751|Ga0194029_1030857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 847 | Open in IMG/M |
| 3300020347|Ga0211504_1000238 | Not Available | 28537 | Open in IMG/M |
| 3300020388|Ga0211678_10003034 | Not Available | 11783 | Open in IMG/M |
| 3300020391|Ga0211675_10115590 | Not Available | 1218 | Open in IMG/M |
| 3300020420|Ga0211580_10148864 | Not Available | 975 | Open in IMG/M |
| 3300020469|Ga0211577_10248202 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300021085|Ga0206677_10192265 | Not Available | 879 | Open in IMG/M |
| 3300021335|Ga0213867_1070084 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300021364|Ga0213859_10163828 | Not Available | 1042 | Open in IMG/M |
| 3300021368|Ga0213860_10010195 | All Organisms → Viruses → Predicted Viral | 3852 | Open in IMG/M |
| 3300021425|Ga0213866_10010234 | Not Available | 5767 | Open in IMG/M |
| 3300021425|Ga0213866_10573433 | Not Available | 529 | Open in IMG/M |
| 3300022068|Ga0212021_1027992 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300022072|Ga0196889_1025353 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300022074|Ga0224906_1003946 | Not Available | 6429 | Open in IMG/M |
| 3300022074|Ga0224906_1059061 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300022074|Ga0224906_1099399 | Not Available | 862 | Open in IMG/M |
| 3300022074|Ga0224906_1179508 | Not Available | 585 | Open in IMG/M |
| 3300022164|Ga0212022_1000324 | All Organisms → Viruses → Predicted Viral | 4282 | Open in IMG/M |
| 3300022178|Ga0196887_1077146 | Not Available | 787 | Open in IMG/M |
| 3300022308|Ga0224504_10504795 | Not Available | 506 | Open in IMG/M |
| 3300024346|Ga0244775_10164041 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300025026|Ga0207879_100843 | All Organisms → Viruses → Predicted Viral | 3046 | Open in IMG/M |
| 3300025071|Ga0207896_1000142 | Not Available | 15811 | Open in IMG/M |
| 3300025084|Ga0208298_1033612 | Not Available | 1063 | Open in IMG/M |
| 3300025084|Ga0208298_1040269 | All Organisms → Viruses | 943 | Open in IMG/M |
| 3300025084|Ga0208298_1040448 | Not Available | 940 | Open in IMG/M |
| 3300025085|Ga0208792_1013485 | Not Available | 1803 | Open in IMG/M |
| 3300025086|Ga0208157_1000552 | Not Available | 19728 | Open in IMG/M |
| 3300025086|Ga0208157_1018815 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300025108|Ga0208793_1175968 | Not Available | 550 | Open in IMG/M |
| 3300025120|Ga0209535_1013736 | Not Available | 4383 | Open in IMG/M |
| 3300025120|Ga0209535_1030867 | Not Available | 2536 | Open in IMG/M |
| 3300025120|Ga0209535_1037580 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300025120|Ga0209535_1045176 | All Organisms → Viruses → Predicted Viral | 1929 | Open in IMG/M |
| 3300025127|Ga0209348_1007698 | All Organisms → Viruses → Predicted Viral | 4463 | Open in IMG/M |
| 3300025132|Ga0209232_1021239 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300025132|Ga0209232_1037984 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1813 | Open in IMG/M |
| 3300025137|Ga0209336_10000957 | Not Available | 14324 | Open in IMG/M |
| 3300025137|Ga0209336_10054175 | Not Available | 1235 | Open in IMG/M |
| 3300025137|Ga0209336_10061261 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300025137|Ga0209336_10073441 | Not Available | 1009 | Open in IMG/M |
| 3300025137|Ga0209336_10093232 | Not Available | 862 | Open in IMG/M |
| 3300025137|Ga0209336_10108966 | Not Available | 772 | Open in IMG/M |
| 3300025137|Ga0209336_10192499 | Not Available | 507 | Open in IMG/M |
| 3300025168|Ga0209337_1000635 | Not Available | 28241 | Open in IMG/M |
| 3300025168|Ga0209337_1074166 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300025280|Ga0208449_1029956 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300025769|Ga0208767_1017090 | All Organisms → Viruses → Predicted Viral | 4175 | Open in IMG/M |
| 3300025853|Ga0208645_1050332 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300025889|Ga0208644_1049742 | Not Available | 2334 | Open in IMG/M |
| 3300027753|Ga0208305_10043448 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300027788|Ga0209711_10111638 | Not Available | 1365 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10504715 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 569 | Open in IMG/M |
| 3300029302|Ga0135227_1024139 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 632 | Open in IMG/M |
| 3300029309|Ga0183683_1000986 | Not Available | 12695 | Open in IMG/M |
| 3300029309|Ga0183683_1024364 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300029448|Ga0183755_1003488 | Not Available | 7860 | Open in IMG/M |
| 3300029787|Ga0183757_1001431 | Not Available | 10214 | Open in IMG/M |
| 3300029787|Ga0183757_1020434 | Not Available | 1589 | Open in IMG/M |
| 3300031851|Ga0315320_10134686 | Not Available | 1865 | Open in IMG/M |
| 3300031851|Ga0315320_10419491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300032277|Ga0316202_10117461 | Not Available | 1233 | Open in IMG/M |
| 3300032277|Ga0316202_10458561 | Not Available | 598 | Open in IMG/M |
| 3300032373|Ga0316204_11164619 | Not Available | 539 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.36% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 22.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.13% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.29% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.07% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.84% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.23% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.23% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.23% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.23% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.61% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.61% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.61% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.61% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.61% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.61% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300003542 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100523113 | 3300000101 | Marine | MKAKKHTQIQRILRLENIVTQLYVKVEGLKLIVDKENEETDKQPK* |
| DelMOSum2010_101256532 | 3300000101 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQPK* |
| DelMOSum2010_101608413 | 3300000101 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKE |
| DelMOSpr2010_1000221714 | 3300000116 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENEETDEQQK* |
| DelMOSpr2010_100459034 | 3300000116 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIIDKENEETDKEPK* |
| DelMOSpr2010_100777043 | 3300000116 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQPK* |
| DelMOWin2010_101107862 | 3300000117 | Marine | MKKKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKKEKNKDEQKD* |
| LPaug09P1610mDRAFT_10083754 | 3300000149 | Marine | MINKKKHTQLQRILRLENIVSQMYVKIEALKLIVDKDSDKKK* |
| JGI24006J15134_1000036832 | 3300001450 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEETDEQQK* |
| JGI24006J15134_100218913 | 3300001450 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSKD* |
| JGI24006J15134_100399173 | 3300001450 | Marine | MIKKKKHTQLQRILRLENIVAQMYVKIEALKLIIDKGSDKKK* |
| JGI24006J15134_100757523 | 3300001450 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED* |
| JGI24006J15134_100878861 | 3300001450 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDK |
| JGI24003J15210_100342623 | 3300001460 | Marine | MKPKKHTQIQRILRLENIVSQLYVQIEAIKLTLAKKDENKKIDLEKDKG |
| JGI24003J15210_100447682 | 3300001460 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSKD* |
| JGI24003J15210_100551463 | 3300001460 | Marine | MIKKKKHTQLQRILRLENIVAQMYVKIEALKLIIDKGSNKKK* |
| JGI24003J15210_100619012 | 3300001460 | Marine | MIKKKKHTQIQRILRLENIVAQMYVKIEALKLIIDKDSDKKK* |
| JGI24003J15210_100621012 | 3300001460 | Marine | MINKKKHTQLQRILRLENIVSQMYVKIEALKLIIDKDSDKKK* |
| JGI24003J15210_100982153 | 3300001460 | Marine | MKKKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEK |
| JGI24003J15210_101434641 | 3300001460 | Marine | QIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD* |
| JGI24004J15324_1000071230 | 3300001472 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENENKETNLQEDKR* |
| JGI24004J15324_100358904 | 3300001472 | Marine | MINKKKHTQLQRILRLENIVSQMYVKIEALKLIXDKDSDKKK* |
| JGI24004J15324_100561721 | 3300001472 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKE |
| JGI24004J15324_100945571 | 3300001472 | Marine | KKKHTQMQRILRLENIVSQMYVKIEALKLIIDKDSNKKK* |
| GOS2244_10023294 | 3300001946 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEAIKLIIDKENEKEKTEN* |
| JGI25127J35165_10072001 | 3300002482 | Marine | LKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD* |
| FS900DNA_101749102 | 3300003542 | Diffuse Hydrothermal Flow Volcanic Vent | MKPKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED* |
| Ga0073579_11519472 | 3300005239 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEAIKVTLEKKDEKKDEEKKD* |
| Ga0073579_116966033 | 3300005239 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIIDKENEETDKQPK* |
| Ga0066377_101454792 | 3300005934 | Marine | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLEKKDEKKKD*LY* |
| Ga0070743_100564923 | 3300005941 | Estuarine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENEETD |
| Ga0098038_10061878 | 3300006735 | Marine | MKPKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKKEKNKDEQKD* |
| Ga0098038_10137527 | 3300006735 | Marine | MKPKKHTQIQRILRLENIVAQLYVKIEAIKIKLEKKDEQKD* |
| Ga0098037_10619553 | 3300006737 | Marine | MKPKKHTQIQRILRLENIVAQLYVKIEAIKIKLEKKDEQKD*L |
| Ga0098054_10676583 | 3300006789 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED* |
| Ga0098055_10880092 | 3300006793 | Marine | MKKKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETEKQPK* |
| Ga0098055_12615592 | 3300006793 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQ |
| Ga0070749_1000688614 | 3300006802 | Aqueous | MKQKKYTQIQRIKRLENIVAQLYYSVEAIKKTLKIEVDENETDKQSGPAD* |
| Ga0070754_100258068 | 3300006810 | Aqueous | MKAKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKDEEKKD* |
| Ga0070750_100385891 | 3300006916 | Aqueous | KHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQKD* |
| Ga0070750_103318802 | 3300006916 | Aqueous | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKVKSED* |
| Ga0070746_101054544 | 3300006919 | Aqueous | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQKD* |
| Ga0070746_102832502 | 3300006919 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEQKD*LY* |
| Ga0070746_103198203 | 3300006919 | Aqueous | MKQKKHTQIQRILRLENIVTQLYVKVEGLKLIVDKENEETDKQQK* |
| Ga0070746_104348452 | 3300006919 | Aqueous | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQKD*LY* |
| Ga0070748_10453022 | 3300006920 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD* |
| Ga0070748_11402102 | 3300006920 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQQK* |
| Ga0098060_11841952 | 3300006921 | Marine | MKAKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKKEKNKDEQKD* |
| Ga0098051_10607052 | 3300006924 | Marine | MKKKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENE |
| Ga0098036_11994132 | 3300006929 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD* |
| Ga0070747_11293973 | 3300007276 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQP |
| Ga0070747_11731923 | 3300007276 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQQ |
| Ga0070747_13088861 | 3300007276 | Aqueous | LLFNRRIMKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKEKD* |
| Ga0102822_10587093 | 3300007558 | Estuarine | MKQKKHTQIQRILRLENIAAQMYVKLEALKLIIDKENEETDKQQK* |
| Ga0098043_11645822 | 3300010148 | Marine | MKEKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED* |
| Ga0098056_11164731 | 3300010150 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENENKETNLEEDKR* |
| Ga0098056_11821571 | 3300010150 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKIIVDKENENKETNLEEDKR* |
| Ga0118731_1059524011 | 3300010392 | Marine | MKPKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKKEKKKDEQKD* |
| Ga0118733_1064225282 | 3300010430 | Marine Sediment | MKQKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKQEKNKDEQ |
| Ga0118733_1085652802 | 3300010430 | Marine Sediment | MKPKKHTQIQRILRLENVVAQLNVQKEAIKLTLSKKEKKKDEQKD* |
| Ga0151671_10156783 | 3300011253 | Marine | MKTKKHTQIQRILRLENIVAQLYVKVEGLKLIIDKENEKVKSED* |
| Ga0163109_110070582 | 3300012936 | Surface Seawater | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKNKDEQKD* |
| Ga0129327_109178692 | 3300013010 | Freshwater To Marine Saline Gradient | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQ |
| Ga0180120_103844721 | 3300017697 | Freshwater To Marine Saline Gradient | KHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKKSED |
| Ga0181403_10033872 | 3300017710 | Seawater | MKLKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0181391_10187895 | 3300017713 | Seawater | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENE |
| Ga0181412_10054306 | 3300017714 | Seawater | MKQKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENKETDKQPK |
| Ga0181390_10991181 | 3300017719 | Seawater | IQRILRLENIVAQMYVKLEALKLIIDKENEKEKSED |
| Ga0181383_10641063 | 3300017720 | Seawater | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKQKDEQKD |
| Ga0181388_100433712 | 3300017724 | Seawater | MKAKKHTQKQRILRLENIVAQMYVKLEALKLIIDKDNEEEKSED |
| Ga0181381_10470941 | 3300017726 | Seawater | MKPKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0181401_11612703 | 3300017727 | Seawater | QRILRLENIVAQLYVKVEGLKLIVDKENEETDKQPK |
| Ga0181416_10464351 | 3300017731 | Seawater | MKAKKHTQIQRILRLENIVAQLYVQIEGIKLTLEKKDEKKKD |
| Ga0181431_10155011 | 3300017735 | Seawater | QIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0187218_10184916 | 3300017737 | Seawater | MKPKKHTQIQRILRLENIVSQLYVQIEAIKLTLAKK |
| Ga0181428_10777702 | 3300017738 | Seawater | LKPKKHTQIQRILRLENIVAQLYVKIEAIKIKLEKKDEQKD |
| Ga0181433_10110261 | 3300017739 | Seawater | KKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0181433_10294372 | 3300017739 | Seawater | MKQKKHTHIQRILRLENIVAQMYVKLEALKLIIDKRQINKKK |
| Ga0181433_10607943 | 3300017739 | Seawater | MKAKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKDXL |
| Ga0181402_10517903 | 3300017743 | Seawater | MKQKKHTQLQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0181402_10785131 | 3300017743 | Seawater | MKLKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0181407_10044326 | 3300017753 | Seawater | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKVKSED |
| Ga0181411_10266965 | 3300017755 | Seawater | MKQKKHTQIQRILRLENIVSQLYVQIEAIKLALAKNEEKTDTSI |
| Ga0181411_10516683 | 3300017755 | Seawater | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNE |
| Ga0181411_12341912 | 3300017755 | Seawater | MKLKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEEEKSED |
| Ga0181420_11363652 | 3300017757 | Seawater | MKAKKHTQILRILRLENIVAQMYVQIEAIKVTLEKKDEKKDEEKKD |
| Ga0181414_10398884 | 3300017759 | Seawater | MKPKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0181422_10140783 | 3300017762 | Seawater | MKQKKHTQIQRILRLENIVSQLYVQIQAIKLTLAKNEEKTDTSI |
| Ga0181385_10719763 | 3300017764 | Seawater | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSEN |
| Ga0181430_10126063 | 3300017772 | Seawater | MKPKKHTQIQRILRLENIVAQLYVKIEAIKIKLEKKD |
| Ga0181430_11069542 | 3300017772 | Seawater | MKQKKHTLIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKDEEKKD |
| Ga0181386_11907491 | 3300017773 | Seawater | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENKDDKED |
| Ga0181395_10528045 | 3300017779 | Seawater | AKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD |
| Ga0181423_10829442 | 3300017781 | Seawater | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTVEKKDEKNKN |
| Ga0181380_10391255 | 3300017782 | Seawater | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKNEEKTDTSI |
| Ga0181380_10633373 | 3300017782 | Seawater | MKQKKYTQIQRILRLENIVSQLYVQIEAIKLTLTKNEEKTDTSI |
| Ga0181424_100224423 | 3300017786 | Seawater | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENEETDKQQK |
| Ga0181553_103005512 | 3300018416 | Salt Marsh | MKPKKHTQLQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0194029_10308572 | 3300019751 | Freshwater | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKD |
| Ga0211504_100023821 | 3300020347 | Marine | MKKKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENEETDKQQK |
| Ga0211678_1000303416 | 3300020388 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0211675_101155903 | 3300020391 | Marine | MKQKKHTQIQRILRLENIVAQLYVQIQAIKLTLAKNEENKD |
| Ga0211580_101488642 | 3300020420 | Marine | MIKKKKHTQIQRILRLENIVAQMYVKIEALKLIIDKDSDKKK |
| Ga0211577_102482023 | 3300020469 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEEEKSED |
| Ga0206677_101922652 | 3300021085 | Seawater | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0213867_10700845 | 3300021335 | Seawater | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKVKSED |
| Ga0213859_101638282 | 3300021364 | Seawater | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQKDXLY |
| Ga0213860_100101956 | 3300021368 | Seawater | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0213866_100102348 | 3300021425 | Seawater | MKAKKHTQIQRILRLENIVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0213866_105734332 | 3300021425 | Seawater | MKPKKHTQIQRILRLENIIAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0212021_10279923 | 3300022068 | Aqueous | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKKKDEQKD |
| Ga0196889_10253531 | 3300022072 | Aqueous | IQRILRLENIVTQLYVKVEGLKLIVDKENEETDKQPK |
| Ga0224906_100394615 | 3300022074 | Seawater | MKQKKHTHIQRILRLENIVAQMYVKLEALKLIIDKRQTNKKK |
| Ga0224906_10590613 | 3300022074 | Seawater | MKQKKHTQIQRILRLENIVAQLYVQIEGIKLTLEKKDEKKKD |
| Ga0224906_10993993 | 3300022074 | Seawater | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLAKNEEKTDTSI |
| Ga0224906_11795082 | 3300022074 | Seawater | QIQRILRLENVVAQLYVQIEAIKLTLEKKDEKKKD |
| Ga0212022_10003248 | 3300022164 | Aqueous | MKAKKHTQIQRILRLENIVTQLYVKVEGLKLIVDKENEETDKQPK |
| Ga0196887_10771462 | 3300022178 | Aqueous | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQQK |
| Ga0224504_105047952 | 3300022308 | Sediment | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENENKETSLEEDKR |
| Ga0244775_101640412 | 3300024346 | Estuarine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENEETDEQQK |
| Ga0207879_1008435 | 3300025026 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSKD |
| Ga0207896_10001427 | 3300025071 | Marine | MINKKKHTQLQRILRLENIVSQMYVKIEALKLIIDKDSDKKK |
| Ga0208298_10336122 | 3300025084 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETEKQPK |
| Ga0208298_10402692 | 3300025084 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQPK |
| Ga0208298_10404481 | 3300025084 | Marine | MKQKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENKETDKQPK |
| Ga0208792_10134851 | 3300025085 | Marine | MKKKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENENKETNL |
| Ga0208157_100055211 | 3300025086 | Marine | MKPKKHTQIQRILRLENIVAQLYVKIEAIKIKLEKKDEQKD |
| Ga0208157_10188151 | 3300025086 | Marine | MKPKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKKEKNKDEQKD |
| Ga0208793_11759682 | 3300025108 | Marine | MKKKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKEN |
| Ga0209535_10137368 | 3300025120 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKKD |
| Ga0209535_10308673 | 3300025120 | Marine | MIKKKKHTQLQRILRLENIVAQMYVKIEALKLIIDKGSDKKK |
| Ga0209535_10375803 | 3300025120 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSKD |
| Ga0209535_10451762 | 3300025120 | Marine | MKKKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0209348_10076986 | 3300025127 | Marine | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEKNKDEQKD |
| Ga0209232_10212392 | 3300025132 | Marine | MKAKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEEKKD |
| Ga0209232_10379841 | 3300025132 | Marine | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLSKN |
| Ga0209336_100009573 | 3300025137 | Marine | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENENKETNLQEDKR |
| Ga0209336_100541753 | 3300025137 | Marine | KKKKHTQLQRILRLENIVAQMYVKIEALKLIIDKGSNKKK |
| Ga0209336_100612611 | 3300025137 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDN |
| Ga0209336_100734411 | 3300025137 | Marine | MIKKKKHTQMQRILRLENIVAQMYVKIEALKLIIDKGSDKKK |
| Ga0209336_100932321 | 3300025137 | Marine | MIKKKKHTQLQRILRLENIVAQMYVKIEALKLIID |
| Ga0209336_101089661 | 3300025137 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDN |
| Ga0209336_101924992 | 3300025137 | Marine | KQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0209337_100063534 | 3300025168 | Marine | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEETDEQQK |
| Ga0209337_10741665 | 3300025168 | Marine | KKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKSED |
| Ga0208449_10299565 | 3300025280 | Deep Ocean | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKDNEKEKS |
| Ga0208767_10170901 | 3300025769 | Aqueous | MKPKKHTQIQRILRLENVVAQLYVQIEAIKLTLSKKEK |
| Ga0208645_10503322 | 3300025853 | Aqueous | MKAKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKDEEKKD |
| Ga0208644_10497424 | 3300025889 | Aqueous | MKQKKYTQIQRIKRLENIVAQLYYSVEAIKKTLKIEVDENETDKQSGPAD |
| Ga0208305_100434481 | 3300027753 | Estuarine | MKQKKHTQIQRILRLENIVAQMYVKVEALKLIIDKEN |
| Ga0209711_101116384 | 3300027788 | Marine | MNKKKHTQIQRILRLENIVTQLYIKVDALKTIIDKQQRDEEQ |
| (restricted) Ga0233414_105047152 | 3300028045 | Seawater | MKQKKHTQIQRILRLENIVAQMYVKVEALKLIIDKENKETDKQQK |
| Ga0135227_10241392 | 3300029302 | Marine Harbor | MKQKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKDEEKKD |
| Ga0183683_10009866 | 3300029309 | Marine | MKAKKHTQIQRILRLENIVAQMYVKLEAIKLTLEKKDEKKKD |
| Ga0183683_10243643 | 3300029309 | Marine | MKPKKHTQIQRILRLENIVAQMYVKLEALKIIIDKENKQENKKTKNNGNT |
| Ga0183755_100348813 | 3300029448 | Marine | MKQKKHTQIQRILRLENIVAQMYVQIEAIKVTLEKKDEKKNEEKKD |
| Ga0183757_100143125 | 3300029787 | Marine | MKQKKHTQIQRILRLENIVAQLYVQIEAIKLTLAKKDDKKD |
| Ga0183757_10204343 | 3300029787 | Marine | MKQKKHTQIQRILRLENIVSQLYVQIEAIKLTLAKNEEKTDTSI |
| Ga0315320_101346863 | 3300031851 | Seawater | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENENKETNLEEDKR |
| Ga0315320_104194912 | 3300031851 | Seawater | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIVDKENENKETKII |
| Ga0316202_101174612 | 3300032277 | Microbial Mat | MKAKKHTQIQRILRLENIVAQLYVKVEALKLIIDKENEETDKEPK |
| Ga0316202_104585612 | 3300032277 | Microbial Mat | MKQKKHTQIQRILRLENIVAQMYVKLEALKLIIDKENKDDKED |
| Ga0316204_111646192 | 3300032373 | Microbial Mat | MKAKKHTQIQRILRLENIVAQLYVKVEGLKLIVDKENEETDKQPK |
| ⦗Top⦘ |