


| Basic Information | |
|---|---|
| Taxon OID | 3300029327 Open in IMG/M |
| Scaffold ID | Ga0243509_100455 Open in IMG/M |
| Source Dataset Name | Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Tokyo University of Pharmacy and Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 34131 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 20 (60.61%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm → Electrode-Associated Soil And Biofilms Microbial Communities From Mfcs In Japan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan: Tokyo | |||||||
| Coordinates | Lat. (o) | 35.638 | Long. (o) | 139.3817 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051648 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0243509_1004551 | F051648 | N/A | MTAGIGTGQLAELVKQVQAGNKVLLTQGNKPVAKIVPAPQETAQSTDLRIRSLRGLRILTPVISQADIAEEMFRRE |
| ⦗Top⦘ |