


| Basic Information | |
|---|---|
| Taxon OID | 3300020141 Open in IMG/M |
| Scaffold ID | Ga0211732_1409482 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | SciLifeLab |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1083 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → unclassified Thermoanaerobacterales → Thermoanaerobacterales bacterium 50_218 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erken, Sweden | |||||||
| Coordinates | Lat. (o) | 59.83763399 | Long. (o) | 18.6203826 | Alt. (m) | Depth (m) | 10 to 20 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001443 | Metagenome / Metatranscriptome | 693 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211732_14094824 | F001443 | AGGAG | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| ⦗Top⦘ |