


| Basic Information | |
|---|---|
| Family ID | F001443 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 693 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPMYETTVRTPEGEKKDRVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Number of Associated Samples | 284 |
| Number of Associated Scaffolds | 693 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.22 % |
| % of genes near scaffold ends (potentially truncated) | 20.92 % |
| % of genes from short scaffolds (< 2000 bps) | 67.24 % |
| Associated GOLD sequencing projects | 257 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.310 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.48% β-sheet: 24.68% Coil/Unstructured: 55.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 693 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 7.79 |
| PF01192 | RNA_pol_Rpb6 | 4.33 |
| PF00004 | AAA | 3.61 |
| PF07733 | DNA_pol3_alpha | 2.60 |
| PF04308 | RNaseH_like | 2.02 |
| PF04055 | Radical_SAM | 2.02 |
| PF09967 | DUF2201 | 1.30 |
| PF00149 | Metallophos | 1.01 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.01 |
| PF00730 | HhH-GPD | 1.01 |
| PF13186 | SPASM | 1.01 |
| PF02668 | TauD | 0.87 |
| PF00487 | FA_desaturase | 0.87 |
| PF13203 | DUF2201_N | 0.87 |
| PF11443 | DUF2828 | 0.72 |
| PF08242 | Methyltransf_12 | 0.72 |
| PF00186 | DHFR_1 | 0.72 |
| PF03401 | TctC | 0.58 |
| PF05118 | Asp_Arg_Hydrox | 0.58 |
| PF13489 | Methyltransf_23 | 0.58 |
| PF01521 | Fe-S_biosyn | 0.58 |
| PF02675 | AdoMet_dc | 0.58 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.43 |
| PF01844 | HNH | 0.43 |
| PF02562 | PhoH | 0.43 |
| PF13847 | Methyltransf_31 | 0.43 |
| PF00639 | Rotamase | 0.43 |
| PF13578 | Methyltransf_24 | 0.29 |
| PF00578 | AhpC-TSA | 0.29 |
| PF08241 | Methyltransf_11 | 0.29 |
| PF01370 | Epimerase | 0.29 |
| PF00012 | HSP70 | 0.29 |
| PF01048 | PNP_UDP_1 | 0.29 |
| PF00226 | DnaJ | 0.29 |
| PF13616 | Rotamase_3 | 0.29 |
| PF06508 | QueC | 0.29 |
| PF01041 | DegT_DnrJ_EryC1 | 0.29 |
| PF04820 | Trp_halogenase | 0.29 |
| PF01503 | PRA-PH | 0.29 |
| PF09834 | DUF2061 | 0.29 |
| PF02945 | Endonuclease_7 | 0.29 |
| PF00782 | DSPc | 0.29 |
| PF02627 | CMD | 0.14 |
| PF00081 | Sod_Fe_N | 0.14 |
| PF01063 | Aminotran_4 | 0.14 |
| PF13439 | Glyco_transf_4 | 0.14 |
| PF13385 | Laminin_G_3 | 0.14 |
| PF14279 | HNH_5 | 0.14 |
| PF01970 | TctA | 0.14 |
| PF05292 | MCD | 0.14 |
| PF03851 | UvdE | 0.14 |
| PF01068 | DNA_ligase_A_M | 0.14 |
| PF00474 | SSF | 0.14 |
| PF01592 | NifU_N | 0.14 |
| PF13353 | Fer4_12 | 0.14 |
| PF13328 | HD_4 | 0.14 |
| PF00550 | PP-binding | 0.14 |
| PF01242 | PTPS | 0.14 |
| PF04940 | BLUF | 0.14 |
| PF00535 | Glycos_transf_2 | 0.14 |
| PF00596 | Aldolase_II | 0.14 |
| PF10902 | WYL_2 | 0.14 |
| PF00182 | Glyco_hydro_19 | 0.14 |
| PF14235 | DUF4337 | 0.14 |
| PF13671 | AAA_33 | 0.14 |
| PF01258 | zf-dskA_traR | 0.14 |
| PF13394 | Fer4_14 | 0.14 |
| PF14602 | Hexapep_2 | 0.14 |
| PF05345 | He_PIG | 0.14 |
| PF00565 | SNase | 0.14 |
| PF04434 | SWIM | 0.14 |
| PF03069 | FmdA_AmdA | 0.14 |
| PF02777 | Sod_Fe_C | 0.14 |
| PF01467 | CTP_transf_like | 0.14 |
| PF00303 | Thymidylat_synt | 0.14 |
| PF13649 | Methyltransf_25 | 0.14 |
| PF12850 | Metallophos_2 | 0.14 |
| PF07883 | Cupin_2 | 0.14 |
| PF13442 | Cytochrome_CBB3 | 0.14 |
| PF12708 | Pectate_lyase_3 | 0.14 |
| PF05853 | BKACE | 0.14 |
| PF00670 | AdoHcyase_NAD | 0.14 |
| PF13609 | Porin_4 | 0.14 |
| PF00383 | dCMP_cyt_deam_1 | 0.14 |
| PF03237 | Terminase_6N | 0.14 |
| PF05496 | RuvB_N | 0.14 |
| PF11750 | DUF3307 | 0.14 |
| PF08534 | Redoxin | 0.14 |
| PF05711 | TylF | 0.14 |
| PF03330 | DPBB_1 | 0.14 |
| COG ID | Name | Functional Category | % Frequency in 693 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 7.79 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 4.33 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 2.60 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 2.60 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.01 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.01 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.01 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.01 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.01 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.87 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.87 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.58 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.58 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.58 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.43 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.43 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.29 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.29 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.29 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 0.29 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.29 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.29 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.29 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.29 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.29 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.29 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.29 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.29 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.14 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.14 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.14 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.14 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.14 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.14 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.14 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.14 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.14 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.14 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.14 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.14 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.14 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.14 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.14 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.14 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.14 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.14 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.14 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.14 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.69 % |
| Unclassified | root | N/A | 45.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199872024 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10003827 | Not Available | 17624 | Open in IMG/M |
| 3300000756|JGI12421J11937_10032268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1862 | Open in IMG/M |
| 3300001266|B570J13884_101542 | Not Available | 1745 | Open in IMG/M |
| 3300001282|B570J14230_10213782 | Not Available | 528 | Open in IMG/M |
| 3300001605|Draft_10001731 | Not Available | 28322 | Open in IMG/M |
| 3300001839|RCM40_1065481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300001851|RCM31_10120153 | Not Available | 514 | Open in IMG/M |
| 3300002131|M2t2BS1_1141208 | Not Available | 53515 | Open in IMG/M |
| 3300002140|M2t2FKB2_1234770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29085 | Open in IMG/M |
| 3300002144|M2t2BS2_11026466 | Not Available | 4939 | Open in IMG/M |
| 3300002161|JGI24766J26685_10071793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300002195|metazooDRAFT_1212800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300002351|B570J29582_1000863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3843 | Open in IMG/M |
| 3300002408|B570J29032_109150515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300002408|B570J29032_109346816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300002408|B570J29032_109483048 | Not Available | 799 | Open in IMG/M |
| 3300002408|B570J29032_109560681 | Not Available | 874 | Open in IMG/M |
| 3300002447|JGI24768J34885_10004340 | Not Available | 4642 | Open in IMG/M |
| 3300002447|JGI24768J34885_10013180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2735 | Open in IMG/M |
| 3300002476|metazooDRAFT_10748522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300002835|B570J40625_100017346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12452 | Open in IMG/M |
| 3300002835|B570J40625_100106777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3419 | Open in IMG/M |
| 3300002835|B570J40625_100124932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3044 | Open in IMG/M |
| 3300002835|B570J40625_100340038 | Not Available | 1494 | Open in IMG/M |
| 3300002835|B570J40625_100637116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300002835|B570J40625_100666819 | Not Available | 938 | Open in IMG/M |
| 3300002835|B570J40625_100737493 | Not Available | 876 | Open in IMG/M |
| 3300002835|B570J40625_101088262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300002835|B570J40625_101217349 | Not Available | 630 | Open in IMG/M |
| 3300003430|JGI25921J50272_10115987 | Not Available | 564 | Open in IMG/M |
| 3300003754|Ga0005853_1019714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300003783|Ga0007850_1018757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300003813|Ga0007879_1020258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300004095|Ga0007829_10036261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300004095|Ga0007829_10121600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300004123|Ga0066181_10118564 | Not Available | 737 | Open in IMG/M |
| 3300004240|Ga0007787_10081685 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300004240|Ga0007787_10105801 | Not Available | 1319 | Open in IMG/M |
| 3300004481|Ga0069718_13811536 | Not Available | 1365 | Open in IMG/M |
| 3300004481|Ga0069718_15555774 | Not Available | 503 | Open in IMG/M |
| 3300004686|Ga0065173_1000018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24489 | Open in IMG/M |
| 3300004686|Ga0065173_1010131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1742 | Open in IMG/M |
| 3300004686|Ga0065173_1021786 | Not Available | 1174 | Open in IMG/M |
| 3300004686|Ga0065173_1026169 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300004692|Ga0065171_1000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9662 | Open in IMG/M |
| 3300004770|Ga0007804_1011296 | All Organisms → Viruses → Predicted Viral | 2613 | Open in IMG/M |
| 3300004770|Ga0007804_1062739 | All Organisms → Viruses | 966 | Open in IMG/M |
| 3300004770|Ga0007804_1096331 | Not Available | 755 | Open in IMG/M |
| 3300004784|Ga0007744_1245863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300005527|Ga0068876_10000012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 157079 | Open in IMG/M |
| 3300005527|Ga0068876_10018224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4463 | Open in IMG/M |
| 3300005527|Ga0068876_10022098 | Not Available | 4016 | Open in IMG/M |
| 3300005527|Ga0068876_10066591 | Not Available | 2175 | Open in IMG/M |
| 3300005527|Ga0068876_10177898 | Not Available | 1241 | Open in IMG/M |
| 3300005527|Ga0068876_10302648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300005527|Ga0068876_10381926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300005527|Ga0068876_10758910 | Not Available | 515 | Open in IMG/M |
| 3300005527|Ga0068876_10791255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → Thiomonas delicata | 502 | Open in IMG/M |
| 3300005528|Ga0068872_10034074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3293 | Open in IMG/M |
| 3300005528|Ga0068872_10253304 | Not Available | 987 | Open in IMG/M |
| 3300005528|Ga0068872_10402039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300005528|Ga0068872_10620608 | Not Available | 572 | Open in IMG/M |
| 3300005581|Ga0049081_10004065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5503 | Open in IMG/M |
| 3300005581|Ga0049081_10005566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4757 | Open in IMG/M |
| 3300005581|Ga0049081_10030222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2057 | Open in IMG/M |
| 3300005581|Ga0049081_10032648 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300005581|Ga0049081_10034276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1930 | Open in IMG/M |
| 3300005581|Ga0049081_10263452 | All Organisms → Viruses → environmental samples → uncultured virus | 602 | Open in IMG/M |
| 3300005581|Ga0049081_10335835 | Not Available | 515 | Open in IMG/M |
| 3300005582|Ga0049080_10073129 | Not Available | 1175 | Open in IMG/M |
| 3300005582|Ga0049080_10217491 | Not Available | 629 | Open in IMG/M |
| 3300005582|Ga0049080_10231124 | Not Available | 606 | Open in IMG/M |
| 3300005662|Ga0078894_10016713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5870 | Open in IMG/M |
| 3300005662|Ga0078894_10024059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4964 | Open in IMG/M |
| 3300005662|Ga0078894_10027660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4648 | Open in IMG/M |
| 3300005662|Ga0078894_10179780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1910 | Open in IMG/M |
| 3300005662|Ga0078894_10298878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
| 3300005662|Ga0078894_10353654 | Not Available | 1330 | Open in IMG/M |
| 3300005662|Ga0078894_10411242 | Not Available | 1222 | Open in IMG/M |
| 3300005662|Ga0078894_10448657 | Not Available | 1162 | Open in IMG/M |
| 3300005662|Ga0078894_10524738 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300005662|Ga0078894_10595845 | Not Available | 985 | Open in IMG/M |
| 3300005662|Ga0078894_10823271 | Not Available | 811 | Open in IMG/M |
| 3300005662|Ga0078894_11056960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300005662|Ga0078894_11099150 | Not Available | 679 | Open in IMG/M |
| 3300005662|Ga0078894_11221126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300005662|Ga0078894_11594143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300005662|Ga0078894_11612874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300005805|Ga0079957_1015746 | Not Available | 5469 | Open in IMG/M |
| 3300005805|Ga0079957_1017238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5163 | Open in IMG/M |
| 3300005805|Ga0079957_1019261 | All Organisms → Viruses → Predicted Viral | 4821 | Open in IMG/M |
| 3300005805|Ga0079957_1025384 | All Organisms → Viruses → Predicted Viral | 4025 | Open in IMG/M |
| 3300005805|Ga0079957_1030475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3579 | Open in IMG/M |
| 3300005805|Ga0079957_1039473 | Not Available | 3012 | Open in IMG/M |
| 3300005805|Ga0079957_1119111 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300005805|Ga0079957_1214607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300005941|Ga0070743_10001480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8939 | Open in IMG/M |
| 3300006071|Ga0007876_1017381 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
| 3300006101|Ga0007810_1018005 | All Organisms → Viruses | 1655 | Open in IMG/M |
| 3300006109|Ga0007870_1061124 | Not Available | 730 | Open in IMG/M |
| 3300006112|Ga0007857_1033548 | Not Available | 1034 | Open in IMG/M |
| 3300006118|Ga0007859_1065672 | Not Available | 742 | Open in IMG/M |
| 3300006127|Ga0007805_1053526 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006127|Ga0007805_1118422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300006484|Ga0070744_10041992 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300006484|Ga0070744_10110451 | Not Available | 794 | Open in IMG/M |
| 3300006484|Ga0070744_10179973 | Not Available | 604 | Open in IMG/M |
| 3300006484|Ga0070744_10243958 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006875|Ga0075473_10267309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 692 | Open in IMG/M |
| 3300007234|Ga0075460_10279296 | Not Available | 551 | Open in IMG/M |
| 3300007516|Ga0105050_10076519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2280 | Open in IMG/M |
| 3300007538|Ga0099851_1210738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I | 704 | Open in IMG/M |
| 3300007542|Ga0099846_1143045 | Not Available | 863 | Open in IMG/M |
| 3300007553|Ga0102819_1045942 | Not Available | 738 | Open in IMG/M |
| 3300007555|Ga0102817_1100217 | Not Available | 637 | Open in IMG/M |
| 3300007562|Ga0102915_1021560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2140 | Open in IMG/M |
| 3300007622|Ga0102863_1157492 | Not Available | 669 | Open in IMG/M |
| 3300007665|Ga0102908_1130169 | Not Available | 519 | Open in IMG/M |
| 3300007708|Ga0102859_1196004 | Not Available | 600 | Open in IMG/M |
| 3300007861|Ga0105736_1115995 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300007960|Ga0099850_1384838 | Not Available | 521 | Open in IMG/M |
| 3300007972|Ga0105745_1298834 | Not Available | 526 | Open in IMG/M |
| 3300008055|Ga0108970_10416162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 865 | Open in IMG/M |
| 3300008055|Ga0108970_10465395 | Not Available | 1261 | Open in IMG/M |
| 3300008107|Ga0114340_1000070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 260759 | Open in IMG/M |
| 3300008107|Ga0114340_1000101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 61244 | Open in IMG/M |
| 3300008107|Ga0114340_1000386 | Not Available | 36874 | Open in IMG/M |
| 3300008107|Ga0114340_1001362 | Not Available | 15151 | Open in IMG/M |
| 3300008107|Ga0114340_1002349 | Not Available | 11168 | Open in IMG/M |
| 3300008107|Ga0114340_1003666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9911 | Open in IMG/M |
| 3300008107|Ga0114340_1012032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16279 | Open in IMG/M |
| 3300008107|Ga0114340_1014713 | Not Available | 5137 | Open in IMG/M |
| 3300008107|Ga0114340_1027700 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300008107|Ga0114340_1035781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3699 | Open in IMG/M |
| 3300008107|Ga0114340_1036640 | Not Available | 2215 | Open in IMG/M |
| 3300008107|Ga0114340_1094151 | Not Available | 1210 | Open in IMG/M |
| 3300008107|Ga0114340_1131873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300008107|Ga0114340_1144728 | Not Available | 885 | Open in IMG/M |
| 3300008107|Ga0114340_1155006 | Not Available | 838 | Open in IMG/M |
| 3300008107|Ga0114340_1234055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300008108|Ga0114341_10001367 | Not Available | 36145 | Open in IMG/M |
| 3300008108|Ga0114341_10003793 | Not Available | 23401 | Open in IMG/M |
| 3300008108|Ga0114341_10009158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7793 | Open in IMG/M |
| 3300008108|Ga0114341_10031461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4659 | Open in IMG/M |
| 3300008108|Ga0114341_10230677 | Not Available | 1011 | Open in IMG/M |
| 3300008110|Ga0114343_1025162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3618 | Open in IMG/M |
| 3300008111|Ga0114344_1007980 | Not Available | 7366 | Open in IMG/M |
| 3300008111|Ga0114344_1010909 | All Organisms → Viruses → Predicted Viral | 3775 | Open in IMG/M |
| 3300008111|Ga0114344_1134149 | Not Available | 864 | Open in IMG/M |
| 3300008113|Ga0114346_1014506 | Not Available | 4374 | Open in IMG/M |
| 3300008113|Ga0114346_1023575 | All Organisms → Viruses → Predicted Viral | 3285 | Open in IMG/M |
| 3300008113|Ga0114346_1171056 | Not Available | 902 | Open in IMG/M |
| 3300008114|Ga0114347_1010206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5632 | Open in IMG/M |
| 3300008114|Ga0114347_1108956 | Not Available | 1057 | Open in IMG/M |
| 3300008116|Ga0114350_1002695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9914 | Open in IMG/M |
| 3300008116|Ga0114350_1003620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25484 | Open in IMG/M |
| 3300008116|Ga0114350_1008343 | Not Available | 7556 | Open in IMG/M |
| 3300008116|Ga0114350_1024047 | All Organisms → Viruses → Predicted Viral | 2489 | Open in IMG/M |
| 3300008116|Ga0114350_1063572 | Not Available | 1287 | Open in IMG/M |
| 3300008116|Ga0114350_1107366 | Not Available | 868 | Open in IMG/M |
| 3300008116|Ga0114350_1176576 | Not Available | 555 | Open in IMG/M |
| 3300008117|Ga0114351_1333355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300008117|Ga0114351_1413878 | Not Available | 564 | Open in IMG/M |
| 3300008120|Ga0114355_1006947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6613 | Open in IMG/M |
| 3300008120|Ga0114355_1140419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300008120|Ga0114355_1256144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 511 | Open in IMG/M |
| 3300008259|Ga0114841_1263604 | Not Available | 548 | Open in IMG/M |
| 3300008261|Ga0114336_1000956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31527 | Open in IMG/M |
| 3300008262|Ga0114337_1016148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4745 | Open in IMG/M |
| 3300008262|Ga0114337_1079899 | Not Available | 1586 | Open in IMG/M |
| 3300008262|Ga0114337_1108795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
| 3300008266|Ga0114363_1000902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18502 | Open in IMG/M |
| 3300008267|Ga0114364_1022876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2564 | Open in IMG/M |
| 3300008267|Ga0114364_1093892 | Not Available | 950 | Open in IMG/M |
| 3300008267|Ga0114364_1146676 | Not Available | 658 | Open in IMG/M |
| 3300008267|Ga0114364_1196698 | Not Available | 501 | Open in IMG/M |
| 3300008448|Ga0114876_1119492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300008450|Ga0114880_1222204 | Not Available | 613 | Open in IMG/M |
| 3300008962|Ga0104242_1021639 | Not Available | 1111 | Open in IMG/M |
| 3300008999|Ga0102816_1056986 | Not Available | 1167 | Open in IMG/M |
| 3300009026|Ga0102829_1155657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300009026|Ga0102829_1322134 | Not Available | 517 | Open in IMG/M |
| 3300009059|Ga0102830_1021929 | Not Available | 2001 | Open in IMG/M |
| 3300009068|Ga0114973_10000150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 48198 | Open in IMG/M |
| 3300009068|Ga0114973_10005703 | Not Available | 8449 | Open in IMG/M |
| 3300009151|Ga0114962_10024055 | Not Available | 4259 | Open in IMG/M |
| 3300009151|Ga0114962_10542465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300009152|Ga0114980_10118200 | Not Available | 1580 | Open in IMG/M |
| 3300009152|Ga0114980_10145613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1406 | Open in IMG/M |
| 3300009152|Ga0114980_10485051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300009154|Ga0114963_10370031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300009155|Ga0114968_10140731 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
| 3300009158|Ga0114977_10015076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4872 | Open in IMG/M |
| 3300009158|Ga0114977_10645719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300009159|Ga0114978_10002122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16455 | Open in IMG/M |
| 3300009159|Ga0114978_10002378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15473 | Open in IMG/M |
| 3300009159|Ga0114978_10325819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300009159|Ga0114978_10333903 | Not Available | 921 | Open in IMG/M |
| 3300009160|Ga0114981_10588351 | Not Available | 592 | Open in IMG/M |
| 3300009163|Ga0114970_10732859 | Not Available | 523 | Open in IMG/M |
| 3300009169|Ga0105097_10026735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3069 | Open in IMG/M |
| 3300009182|Ga0114959_10046345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2550 | Open in IMG/M |
| 3300009183|Ga0114974_10006372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8725 | Open in IMG/M |
| 3300009183|Ga0114974_10328645 | Not Available | 892 | Open in IMG/M |
| 3300009183|Ga0114974_10481440 | Not Available | 699 | Open in IMG/M |
| 3300009183|Ga0114974_10618796 | Not Available | 595 | Open in IMG/M |
| 3300009183|Ga0114974_10685688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009183|Ga0114974_10764498 | Not Available | 521 | Open in IMG/M |
| 3300009184|Ga0114976_10012592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5219 | Open in IMG/M |
| 3300009184|Ga0114976_10317787 | Not Available | 830 | Open in IMG/M |
| 3300009184|Ga0114976_10404427 | Not Available | 714 | Open in IMG/M |
| 3300009185|Ga0114971_10570801 | Not Available | 627 | Open in IMG/M |
| 3300009194|Ga0114983_1037456 | Not Available | 1188 | Open in IMG/M |
| 3300009257|Ga0103869_10133350 | Not Available | 645 | Open in IMG/M |
| 3300009387|Ga0103871_1011799 | Not Available | 681 | Open in IMG/M |
| 3300009387|Ga0103871_1022056 | Not Available | 529 | Open in IMG/M |
| 3300009419|Ga0114982_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 136870 | Open in IMG/M |
| 3300009419|Ga0114982_1009632 | Not Available | 3451 | Open in IMG/M |
| 3300009419|Ga0114982_1037655 | All Organisms → Viruses → Predicted Viral | 1553 | Open in IMG/M |
| 3300009419|Ga0114982_1095289 | Not Available | 921 | Open in IMG/M |
| 3300009472|Ga0115554_1311680 | Not Available | 622 | Open in IMG/M |
| 3300009502|Ga0114951_10008253 | Not Available | 8590 | Open in IMG/M |
| 3300009502|Ga0114951_10029695 | Not Available | 3517 | Open in IMG/M |
| 3300009508|Ga0115567_10105061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 1947 | Open in IMG/M |
| 3300010157|Ga0114964_10002369 | Not Available | 13133 | Open in IMG/M |
| 3300010158|Ga0114960_10578885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300010160|Ga0114967_10175345 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300010300|Ga0129351_1261750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → environmental samples → uncultured Rhodospirillales bacterium HF0500_23A22 | 660 | Open in IMG/M |
| 3300010334|Ga0136644_10703135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300010354|Ga0129333_10000034 | Not Available | 72449 | Open in IMG/M |
| 3300010354|Ga0129333_10001263 | Not Available | 22682 | Open in IMG/M |
| 3300010354|Ga0129333_10002171 | Not Available | 18155 | Open in IMG/M |
| 3300010354|Ga0129333_10003182 | Not Available | 15327 | Open in IMG/M |
| 3300010354|Ga0129333_10005661 | Not Available | 11766 | Open in IMG/M |
| 3300010354|Ga0129333_10021665 | Not Available | 6102 | Open in IMG/M |
| 3300010354|Ga0129333_10021731 | Not Available | 6094 | Open in IMG/M |
| 3300010354|Ga0129333_10028934 | All Organisms → cellular organisms → Bacteria | 5244 | Open in IMG/M |
| 3300010354|Ga0129333_10062970 | Not Available | 3455 | Open in IMG/M |
| 3300010354|Ga0129333_10065006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3395 | Open in IMG/M |
| 3300010354|Ga0129333_10069130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3281 | Open in IMG/M |
| 3300010354|Ga0129333_10086421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2903 | Open in IMG/M |
| 3300010354|Ga0129333_10105143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2607 | Open in IMG/M |
| 3300010354|Ga0129333_10149942 | Not Available | 2140 | Open in IMG/M |
| 3300010354|Ga0129333_10168586 | Not Available | 2003 | Open in IMG/M |
| 3300010354|Ga0129333_10220239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1721 | Open in IMG/M |
| 3300010354|Ga0129333_10252216 | All Organisms → Viruses | 1590 | Open in IMG/M |
| 3300010354|Ga0129333_10257623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300010354|Ga0129333_10338273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300010354|Ga0129333_10354769 | Not Available | 1304 | Open in IMG/M |
| 3300010354|Ga0129333_10439345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella → Shewanella xiamenensis | 1150 | Open in IMG/M |
| 3300010354|Ga0129333_10546235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300010354|Ga0129333_10739302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300010354|Ga0129333_10925447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300010354|Ga0129333_11007903 | Not Available | 699 | Open in IMG/M |
| 3300010354|Ga0129333_11158236 | Not Available | 644 | Open in IMG/M |
| 3300010354|Ga0129333_11398234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300010354|Ga0129333_11411243 | Not Available | 572 | Open in IMG/M |
| 3300010354|Ga0129333_11460361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300010354|Ga0129333_11460376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300010356|Ga0116237_10385321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300010370|Ga0129336_10024552 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3655 | Open in IMG/M |
| 3300010370|Ga0129336_10148822 | Not Available | 1353 | Open in IMG/M |
| 3300010370|Ga0129336_10299782 | Not Available | 894 | Open in IMG/M |
| 3300010370|Ga0129336_10334992 | Not Available | 835 | Open in IMG/M |
| 3300010374|Ga0114986_1052076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300010885|Ga0133913_10008719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26506 | Open in IMG/M |
| 3300010885|Ga0133913_10094749 | Not Available | 7999 | Open in IMG/M |
| 3300010885|Ga0133913_10431214 | Not Available | 3481 | Open in IMG/M |
| 3300010885|Ga0133913_10452974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3387 | Open in IMG/M |
| 3300010885|Ga0133913_10518259 | Not Available | 3140 | Open in IMG/M |
| 3300010885|Ga0133913_10560286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3005 | Open in IMG/M |
| 3300010885|Ga0133913_11935891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
| 3300010885|Ga0133913_12255863 | Not Available | 1339 | Open in IMG/M |
| 3300010885|Ga0133913_12983304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300010885|Ga0133913_13323312 | Not Available | 1057 | Open in IMG/M |
| 3300011010|Ga0139557_1001764 | All Organisms → Viruses → Predicted Viral | 4932 | Open in IMG/M |
| 3300011011|Ga0139556_1056868 | Not Available | 583 | Open in IMG/M |
| 3300011113|Ga0151517_1002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 320541 | Open in IMG/M |
| 3300011184|Ga0136709_1016424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300011184|Ga0136709_1031530 | Not Available | 732 | Open in IMG/M |
| 3300011184|Ga0136709_1042195 | Not Available | 631 | Open in IMG/M |
| 3300011268|Ga0151620_1259787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300012352|Ga0157138_1080538 | Not Available | 511 | Open in IMG/M |
| 3300012663|Ga0157203_1029806 | Not Available | 768 | Open in IMG/M |
| 3300012663|Ga0157203_1035052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300012665|Ga0157210_1000615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13955 | Open in IMG/M |
| 3300012665|Ga0157210_1001064 | Not Available | 9220 | Open in IMG/M |
| 3300013004|Ga0164293_10000527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30505 | Open in IMG/M |
| 3300013004|Ga0164293_10032433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4322 | Open in IMG/M |
| 3300013004|Ga0164293_10157109 | Not Available | 1684 | Open in IMG/M |
| 3300013004|Ga0164293_10176036 | Not Available | 1567 | Open in IMG/M |
| 3300013004|Ga0164293_10206862 | Not Available | 1413 | Open in IMG/M |
| 3300013004|Ga0164293_10424501 | All Organisms → Viruses | 890 | Open in IMG/M |
| 3300013004|Ga0164293_10472124 | Not Available | 832 | Open in IMG/M |
| 3300013004|Ga0164293_10563600 | Not Available | 744 | Open in IMG/M |
| 3300013004|Ga0164293_10575674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300013005|Ga0164292_10153904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1678 | Open in IMG/M |
| 3300013005|Ga0164292_10367878 | Not Available | 967 | Open in IMG/M |
| 3300013005|Ga0164292_10516448 | Not Available | 781 | Open in IMG/M |
| 3300013005|Ga0164292_10744157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300013006|Ga0164294_10114466 | Not Available | 1984 | Open in IMG/M |
| 3300013006|Ga0164294_10452398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300013087|Ga0163212_1113525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300013093|Ga0164296_1055617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1863 | Open in IMG/M |
| 3300013094|Ga0164297_10025005 | Not Available | 3540 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10161761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1462 | Open in IMG/M |
| 3300017707|Ga0181363_1024850 | Not Available | 1156 | Open in IMG/M |
| 3300017707|Ga0181363_1065011 | Not Available | 636 | Open in IMG/M |
| 3300017716|Ga0181350_1007850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3060 | Open in IMG/M |
| 3300017716|Ga0181350_1032532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1433 | Open in IMG/M |
| 3300017722|Ga0181347_1044133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
| 3300017722|Ga0181347_1133632 | Not Available | 687 | Open in IMG/M |
| 3300017723|Ga0181362_1009464 | Not Available | 2091 | Open in IMG/M |
| 3300017747|Ga0181352_1093913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300017747|Ga0181352_1138351 | Not Available | 650 | Open in IMG/M |
| 3300017747|Ga0181352_1148137 | Not Available | 622 | Open in IMG/M |
| 3300017754|Ga0181344_1025429 | Not Available | 1821 | Open in IMG/M |
| 3300017754|Ga0181344_1142155 | Not Available | 686 | Open in IMG/M |
| 3300017761|Ga0181356_1125738 | Not Available | 814 | Open in IMG/M |
| 3300017766|Ga0181343_1052720 | Not Available | 1194 | Open in IMG/M |
| 3300017766|Ga0181343_1088060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300017766|Ga0181343_1129060 | Not Available | 709 | Open in IMG/M |
| 3300017766|Ga0181343_1133069 | Not Available | 696 | Open in IMG/M |
| 3300017766|Ga0181343_1195080 | All Organisms → Viruses → environmental samples → uncultured virus | 556 | Open in IMG/M |
| 3300017774|Ga0181358_1189583 | All Organisms → Viruses → environmental samples → uncultured virus | 679 | Open in IMG/M |
| 3300017777|Ga0181357_1034085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2006 | Open in IMG/M |
| 3300017778|Ga0181349_1009940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3960 | Open in IMG/M |
| 3300017778|Ga0181349_1033945 | Not Available | 2045 | Open in IMG/M |
| 3300017778|Ga0181349_1056998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1522 | Open in IMG/M |
| 3300017778|Ga0181349_1125317 | Not Available | 943 | Open in IMG/M |
| 3300017778|Ga0181349_1235306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300017784|Ga0181348_1247704 | Not Available | 618 | Open in IMG/M |
| 3300017785|Ga0181355_1149570 | Not Available | 943 | Open in IMG/M |
| 3300017785|Ga0181355_1252204 | Not Available | 676 | Open in IMG/M |
| 3300017788|Ga0169931_10003727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24041 | Open in IMG/M |
| 3300017788|Ga0169931_10086686 | Not Available | 3079 | Open in IMG/M |
| 3300018420|Ga0181563_10739213 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 542 | Open in IMG/M |
| 3300019093|Ga0187843_10008529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5714 | Open in IMG/M |
| 3300019093|Ga0187843_10270454 | Not Available | 702 | Open in IMG/M |
| 3300019122|Ga0188839_1001824 | Not Available | 3524 | Open in IMG/M |
| 3300019122|Ga0188839_1008605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300019784|Ga0181359_1019353 | Not Available | 2564 | Open in IMG/M |
| 3300019784|Ga0181359_1076212 | Not Available | 1264 | Open in IMG/M |
| 3300020074|Ga0194113_10576354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300020141|Ga0211732_1130484 | Not Available | 631 | Open in IMG/M |
| 3300020141|Ga0211732_1250338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2261 | Open in IMG/M |
| 3300020141|Ga0211732_1409482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → unclassified Thermoanaerobacterales → Thermoanaerobacterales bacterium 50_218 | 1083 | Open in IMG/M |
| 3300020141|Ga0211732_1534980 | Not Available | 761 | Open in IMG/M |
| 3300020141|Ga0211732_1560676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300020141|Ga0211732_1567074 | Not Available | 847 | Open in IMG/M |
| 3300020151|Ga0211736_10011651 | All Organisms → Viruses → Predicted Viral | 1839 | Open in IMG/M |
| 3300020151|Ga0211736_10100334 | Not Available | 588 | Open in IMG/M |
| 3300020151|Ga0211736_10199498 | Not Available | 1163 | Open in IMG/M |
| 3300020151|Ga0211736_10310174 | Not Available | 2573 | Open in IMG/M |
| 3300020151|Ga0211736_10418995 | Not Available | 607 | Open in IMG/M |
| 3300020151|Ga0211736_10494418 | Not Available | 1290 | Open in IMG/M |
| 3300020151|Ga0211736_10508198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300020151|Ga0211736_10523420 | Not Available | 687 | Open in IMG/M |
| 3300020151|Ga0211736_10737539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3370 | Open in IMG/M |
| 3300020151|Ga0211736_10983762 | Not Available | 7611 | Open in IMG/M |
| 3300020159|Ga0211734_10019104 | Not Available | 3931 | Open in IMG/M |
| 3300020159|Ga0211734_10222722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300020159|Ga0211734_10364264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10171 | Open in IMG/M |
| 3300020159|Ga0211734_10751666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3977 | Open in IMG/M |
| 3300020159|Ga0211734_11159462 | Not Available | 17483 | Open in IMG/M |
| 3300020160|Ga0211733_10330790 | Not Available | 810 | Open in IMG/M |
| 3300020160|Ga0211733_10909030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1525 | Open in IMG/M |
| 3300020160|Ga0211733_10935710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 1392 | Open in IMG/M |
| 3300020161|Ga0211726_10045768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
| 3300020161|Ga0211726_10314378 | Not Available | 622 | Open in IMG/M |
| 3300020161|Ga0211726_10349614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3696 | Open in IMG/M |
| 3300020161|Ga0211726_10381510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2194 | Open in IMG/M |
| 3300020161|Ga0211726_10489810 | Not Available | 1578 | Open in IMG/M |
| 3300020161|Ga0211726_10668507 | Not Available | 3925 | Open in IMG/M |
| 3300020161|Ga0211726_10685743 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300020161|Ga0211726_10808476 | Not Available | 15398 | Open in IMG/M |
| 3300020161|Ga0211726_10813361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Allochromatium → Allochromatium vinosum | 505 | Open in IMG/M |
| 3300020161|Ga0211726_11041567 | Not Available | 57831 | Open in IMG/M |
| 3300020162|Ga0211735_10255170 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300020162|Ga0211735_10424572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| 3300020162|Ga0211735_10695097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300020162|Ga0211735_11486941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300020166|Ga0206128_1002483 | Not Available | 16523 | Open in IMG/M |
| 3300020172|Ga0211729_10331871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum → Rhizobium mesoamericanum STM3625 | 682 | Open in IMG/M |
| 3300020172|Ga0211729_10352089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2294 | Open in IMG/M |
| 3300020172|Ga0211729_10676174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300020172|Ga0211729_10691520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300020172|Ga0211729_11408736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300020183|Ga0194115_10269554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300020187|Ga0206130_10026601 | Not Available | 4830 | Open in IMG/M |
| 3300020200|Ga0194121_10198237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300020205|Ga0211731_10147677 | Not Available | 1704 | Open in IMG/M |
| 3300020205|Ga0211731_10294743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3070 | Open in IMG/M |
| 3300020205|Ga0211731_10659690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 4548 | Open in IMG/M |
| 3300020205|Ga0211731_10660065 | Not Available | 1307 | Open in IMG/M |
| 3300020205|Ga0211731_10926570 | Not Available | 653 | Open in IMG/M |
| 3300020205|Ga0211731_11266080 | Not Available | 869 | Open in IMG/M |
| 3300020205|Ga0211731_11347351 | All Organisms → Viruses → Predicted Viral | 3752 | Open in IMG/M |
| 3300020205|Ga0211731_11377492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300020205|Ga0211731_11438871 | Not Available | 1659 | Open in IMG/M |
| 3300020205|Ga0211731_11468648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → unclassified Thermoanaerobacterales → Thermoanaerobacterales bacterium 50_218 | 1855 | Open in IMG/M |
| 3300020514|Ga0208202_1002632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I | 3064 | Open in IMG/M |
| 3300020527|Ga0208232_1003041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2907 | Open in IMG/M |
| 3300020528|Ga0208224_1007457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1771 | Open in IMG/M |
| 3300020734|Ga0214235_1063531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300021091|Ga0194133_10172726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
| 3300021138|Ga0214164_1029871 | Not Available | 1380 | Open in IMG/M |
| 3300021519|Ga0194048_10066023 | Not Available | 1432 | Open in IMG/M |
| 3300021519|Ga0194048_10078742 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300021956|Ga0213922_1102119 | Not Available | 578 | Open in IMG/M |
| 3300021958|Ga0222718_10077558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2013 | Open in IMG/M |
| 3300021961|Ga0222714_10009061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8769 | Open in IMG/M |
| 3300021961|Ga0222714_10037385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3518 | Open in IMG/M |
| 3300021961|Ga0222714_10170555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
| 3300021961|Ga0222714_10264536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300021961|Ga0222714_10499024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300021962|Ga0222713_10150500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
| 3300021962|Ga0222713_10167569 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300021962|Ga0222713_10171098 | Not Available | 1479 | Open in IMG/M |
| 3300021962|Ga0222713_10177055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300021962|Ga0222713_10197070 | Not Available | 1351 | Open in IMG/M |
| 3300021962|Ga0222713_10200015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → environmental samples → uncultured Eubacteriales bacterium | 1337 | Open in IMG/M |
| 3300021962|Ga0222713_10381586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300021962|Ga0222713_10510425 | Not Available | 717 | Open in IMG/M |
| 3300021962|Ga0222713_10731682 | Not Available | 560 | Open in IMG/M |
| 3300021963|Ga0222712_10006408 | Not Available | 11632 | Open in IMG/M |
| 3300021963|Ga0222712_10444638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300021963|Ga0222712_10483163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 736 | Open in IMG/M |
| 3300022179|Ga0181353_1145424 | Not Available | 549 | Open in IMG/M |
| 3300022190|Ga0181354_1050410 | Not Available | 1386 | Open in IMG/M |
| 3300022407|Ga0181351_1000882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9206 | Open in IMG/M |
| 3300022407|Ga0181351_1003721 | Not Available | 5586 | Open in IMG/M |
| 3300022407|Ga0181351_1012829 | Not Available | 3441 | Open in IMG/M |
| 3300022407|Ga0181351_1250771 | Not Available | 551 | Open in IMG/M |
| 3300022555|Ga0212088_10021693 | Not Available | 8552 | Open in IMG/M |
| 3300022555|Ga0212088_10054122 | Not Available | 4245 | Open in IMG/M |
| 3300022591|Ga0236341_1000696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20432 | Open in IMG/M |
| 3300022591|Ga0236341_1000895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17653 | Open in IMG/M |
| 3300022591|Ga0236341_1035113 | All Organisms → Viruses | 1380 | Open in IMG/M |
| 3300022591|Ga0236341_1061484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300022602|Ga0248169_105649 | Not Available | 12257 | Open in IMG/M |
| 3300022748|Ga0228702_1083327 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300022752|Ga0214917_10000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 330017 | Open in IMG/M |
| 3300022752|Ga0214917_10266270 | Not Available | 787 | Open in IMG/M |
| 3300023174|Ga0214921_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 349716 | Open in IMG/M |
| 3300023174|Ga0214921_10000019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 337119 | Open in IMG/M |
| 3300023174|Ga0214921_10007274 | Not Available | 14817 | Open in IMG/M |
| 3300023174|Ga0214921_10026964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5798 | Open in IMG/M |
| 3300023174|Ga0214921_10040142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4340 | Open in IMG/M |
| 3300023179|Ga0214923_10219850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300023311|Ga0256681_10672734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300023311|Ga0256681_12419630 | Not Available | 2584 | Open in IMG/M |
| 3300024289|Ga0255147_1000014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 152444 | Open in IMG/M |
| 3300024346|Ga0244775_10006426 | All Organisms → cellular organisms → Bacteria | 11711 | Open in IMG/M |
| 3300024346|Ga0244775_10014072 | Not Available | 7476 | Open in IMG/M |
| 3300024346|Ga0244775_10019228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6259 | Open in IMG/M |
| 3300024346|Ga0244775_10024948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5373 | Open in IMG/M |
| 3300024346|Ga0244775_10914601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300024346|Ga0244775_11185660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300024536|Ga0256338_1158156 | Not Available | 507 | Open in IMG/M |
| 3300024555|Ga0255280_1117725 | Not Available | 523 | Open in IMG/M |
| 3300024564|Ga0255237_1059479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300024863|Ga0255246_1090682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300025091|Ga0209616_1009443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| 3300025091|Ga0209616_1016427 | Not Available | 751 | Open in IMG/M |
| 3300025358|Ga0208504_1014941 | Not Available | 1085 | Open in IMG/M |
| 3300025358|Ga0208504_1033102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300025358|Ga0208504_1040783 | All Organisms → Viruses | 567 | Open in IMG/M |
| 3300025368|Ga0208620_1022755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300025369|Ga0208382_1028906 | All Organisms → Viruses | 701 | Open in IMG/M |
| 3300025383|Ga0208250_1039190 | All Organisms → Viruses | 719 | Open in IMG/M |
| 3300025391|Ga0208740_1009210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1648 | Open in IMG/M |
| 3300025392|Ga0208380_1000789 | Not Available | 7837 | Open in IMG/M |
| 3300025392|Ga0208380_1003372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3282 | Open in IMG/M |
| 3300025396|Ga0208874_1046632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300025418|Ga0208253_1021164 | Not Available | 1305 | Open in IMG/M |
| 3300025423|Ga0208746_1073065 | All Organisms → Viruses | 519 | Open in IMG/M |
| 3300025466|Ga0208497_1000371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22055 | Open in IMG/M |
| 3300025466|Ga0208497_1086877 | Not Available | 582 | Open in IMG/M |
| 3300025467|Ga0208260_1035063 | Not Available | 1066 | Open in IMG/M |
| 3300025723|Ga0208741_10050231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300026568|Ga0255240_1022322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
| 3300027142|Ga0255065_1092024 | Not Available | 504 | Open in IMG/M |
| 3300027365|Ga0209300_1028366 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300027589|Ga0255123_1036397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300027608|Ga0208974_1002222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7302 | Open in IMG/M |
| 3300027608|Ga0208974_1025223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1825 | Open in IMG/M |
| 3300027631|Ga0208133_1031610 | Not Available | 1322 | Open in IMG/M |
| 3300027631|Ga0208133_1066920 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027708|Ga0209188_1108670 | Not Available | 1100 | Open in IMG/M |
| 3300027710|Ga0209599_10000001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 371055 | Open in IMG/M |
| 3300027710|Ga0209599_10000071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 73042 | Open in IMG/M |
| 3300027710|Ga0209599_10002263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8096 | Open in IMG/M |
| 3300027710|Ga0209599_10010016 | Not Available | 2936 | Open in IMG/M |
| 3300027710|Ga0209599_10010576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2830 | Open in IMG/M |
| 3300027710|Ga0209599_10073832 | Not Available | 895 | Open in IMG/M |
| 3300027710|Ga0209599_10190468 | Not Available | 552 | Open in IMG/M |
| 3300027720|Ga0209617_10266996 | Not Available | 646 | Open in IMG/M |
| 3300027720|Ga0209617_10313814 | Not Available | 585 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1192386 | Not Available | 772 | Open in IMG/M |
| 3300027734|Ga0209087_1022650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3072 | Open in IMG/M |
| 3300027734|Ga0209087_1141645 | Not Available | 974 | Open in IMG/M |
| 3300027734|Ga0209087_1214241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300027749|Ga0209084_1344567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027759|Ga0209296_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 356865 | Open in IMG/M |
| 3300027759|Ga0209296_1001097 | Not Available | 21642 | Open in IMG/M |
| 3300027759|Ga0209296_1026261 | Not Available | 3254 | Open in IMG/M |
| 3300027759|Ga0209296_1227295 | Not Available | 781 | Open in IMG/M |
| 3300027759|Ga0209296_1356703 | Not Available | 561 | Open in IMG/M |
| 3300027759|Ga0209296_1402424 | Not Available | 512 | Open in IMG/M |
| 3300027760|Ga0209598_10309019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300027763|Ga0209088_10026751 | Not Available | 2929 | Open in IMG/M |
| 3300027763|Ga0209088_10239436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300027763|Ga0209088_10393405 | Not Available | 536 | Open in IMG/M |
| 3300027769|Ga0209770_10180627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300027782|Ga0209500_10000376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 38823 | Open in IMG/M |
| 3300027782|Ga0209500_10022610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3635 | Open in IMG/M |
| 3300027782|Ga0209500_10232751 | Not Available | 813 | Open in IMG/M |
| 3300027782|Ga0209500_10233248 | Not Available | 812 | Open in IMG/M |
| 3300027793|Ga0209972_10005617 | Not Available | 9188 | Open in IMG/M |
| 3300027793|Ga0209972_10384403 | Not Available | 599 | Open in IMG/M |
| 3300027798|Ga0209353_10054545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1836 | Open in IMG/M |
| 3300027798|Ga0209353_10117481 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300027804|Ga0209358_10121374 | Not Available | 1426 | Open in IMG/M |
| 3300027805|Ga0209229_10081522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300027805|Ga0209229_10250224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300027816|Ga0209990_10006267 | Not Available | 7906 | Open in IMG/M |
| 3300027816|Ga0209990_10191077 | Not Available | 953 | Open in IMG/M |
| 3300027836|Ga0209230_10000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 108797 | Open in IMG/M |
| 3300027836|Ga0209230_10000278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19940 | Open in IMG/M |
| 3300027836|Ga0209230_10009076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4428 | Open in IMG/M |
| 3300027892|Ga0209550_10079346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2525 | Open in IMG/M |
| 3300027892|Ga0209550_10784408 | Not Available | 536 | Open in IMG/M |
| 3300027896|Ga0209777_10475954 | Not Available | 925 | Open in IMG/M |
| 3300027963|Ga0209400_1002811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12994 | Open in IMG/M |
| 3300027969|Ga0209191_1007167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6134 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1049028 | Not Available | 2550 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1192443 | Not Available | 856 | Open in IMG/M |
| 3300027971|Ga0209401_1002826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11124 | Open in IMG/M |
| 3300027971|Ga0209401_1006498 | Not Available | 6933 | Open in IMG/M |
| 3300028025|Ga0247723_1025080 | Not Available | 1948 | Open in IMG/M |
| 3300028025|Ga0247723_1030669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1697 | Open in IMG/M |
| 3300028392|Ga0304729_1024792 | Not Available | 2499 | Open in IMG/M |
| 3300028394|Ga0304730_1304262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1067774 | Not Available | 1708 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1187074 | Not Available | 780 | Open in IMG/M |
| 3300029442|Ga0239579_1006781 | Not Available | 2681 | Open in IMG/M |
| 3300031519|Ga0307488_10037743 | Not Available | 3815 | Open in IMG/M |
| 3300031578|Ga0307376_10380415 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 931 | Open in IMG/M |
| 3300031758|Ga0315907_10007272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11574 | Open in IMG/M |
| 3300031758|Ga0315907_10038154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4289 | Open in IMG/M |
| 3300031758|Ga0315907_10057650 | Not Available | 3395 | Open in IMG/M |
| 3300031758|Ga0315907_10071752 | Not Available | 2998 | Open in IMG/M |
| 3300031758|Ga0315907_10098913 | All Organisms → Viruses → Predicted Viral | 2501 | Open in IMG/M |
| 3300031758|Ga0315907_10231991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
| 3300031758|Ga0315907_10286768 | Not Available | 1355 | Open in IMG/M |
| 3300031758|Ga0315907_10308670 | Not Available | 1297 | Open in IMG/M |
| 3300031758|Ga0315907_10384023 | Not Available | 1135 | Open in IMG/M |
| 3300031758|Ga0315907_10397951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
| 3300031758|Ga0315907_10412109 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300031758|Ga0315907_10692042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300031758|Ga0315907_10974605 | Not Available | 615 | Open in IMG/M |
| 3300031758|Ga0315907_10989299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300031758|Ga0315907_11201583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300031784|Ga0315899_10059252 | All Organisms → Viruses → Predicted Viral | 3990 | Open in IMG/M |
| 3300031784|Ga0315899_10189910 | Not Available | 2076 | Open in IMG/M |
| 3300031784|Ga0315899_10378374 | Not Available | 1382 | Open in IMG/M |
| 3300031784|Ga0315899_11572607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → unclassified Thermoanaerobacterales → Thermoanaerobacterales bacterium 50_218 | 547 | Open in IMG/M |
| 3300031787|Ga0315900_10505528 | Not Available | 914 | Open in IMG/M |
| 3300031787|Ga0315900_10626328 | Not Available | 780 | Open in IMG/M |
| 3300031787|Ga0315900_10722919 | Not Available | 701 | Open in IMG/M |
| 3300031857|Ga0315909_10000268 | Not Available | 67580 | Open in IMG/M |
| 3300031857|Ga0315909_10051892 | Not Available | 3790 | Open in IMG/M |
| 3300031857|Ga0315909_10130015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2109 | Open in IMG/M |
| 3300031857|Ga0315909_10183838 | Not Available | 1677 | Open in IMG/M |
| 3300031857|Ga0315909_10226417 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300031857|Ga0315909_10232321 | All Organisms → Viruses → Predicted Viral | 1431 | Open in IMG/M |
| 3300031857|Ga0315909_10235532 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300031857|Ga0315909_10284221 | Not Available | 1247 | Open in IMG/M |
| 3300031857|Ga0315909_10561619 | Not Available | 772 | Open in IMG/M |
| 3300031857|Ga0315909_10601093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → belli group → Rickettsia bellii → Rickettsia bellii RML369-C | 735 | Open in IMG/M |
| 3300031857|Ga0315909_10698072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300031857|Ga0315909_10741694 | Not Available | 630 | Open in IMG/M |
| 3300031857|Ga0315909_10969596 | Not Available | 517 | Open in IMG/M |
| 3300031951|Ga0315904_10077645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3569 | Open in IMG/M |
| 3300031951|Ga0315904_10289399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1543 | Open in IMG/M |
| 3300031951|Ga0315904_10342281 | Not Available | 1381 | Open in IMG/M |
| 3300031951|Ga0315904_10478298 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300031951|Ga0315904_10513839 | Not Available | 1053 | Open in IMG/M |
| 3300031951|Ga0315904_10639306 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 907 | Open in IMG/M |
| 3300031951|Ga0315904_10998376 | Not Available | 664 | Open in IMG/M |
| 3300031951|Ga0315904_11279817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300031963|Ga0315901_10092908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2808 | Open in IMG/M |
| 3300031963|Ga0315901_10251354 | Not Available | 1495 | Open in IMG/M |
| 3300031963|Ga0315901_10391136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300031963|Ga0315901_10956905 | Not Available | 603 | Open in IMG/M |
| 3300032050|Ga0315906_10027179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6249 | Open in IMG/M |
| 3300032050|Ga0315906_10480993 | Not Available | 1056 | Open in IMG/M |
| 3300032050|Ga0315906_10561154 | Not Available | 950 | Open in IMG/M |
| 3300032050|Ga0315906_10678459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300032093|Ga0315902_10445906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300032093|Ga0315902_11051498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 605 | Open in IMG/M |
| 3300032116|Ga0315903_10042906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4688 | Open in IMG/M |
| 3300032116|Ga0315903_10488453 | Not Available | 976 | Open in IMG/M |
| 3300032116|Ga0315903_10504681 | Not Available | 954 | Open in IMG/M |
| 3300032116|Ga0315903_10675986 | Not Available | 777 | Open in IMG/M |
| 3300032116|Ga0315903_10892385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 636 | Open in IMG/M |
| 3300032665|Ga0316221_1088365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
| 3300033979|Ga0334978_0181069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sutterellaceae → Sutterella → environmental samples → Sutterella wadsworthensis CAG:135 | 1040 | Open in IMG/M |
| 3300033979|Ga0334978_0424807 | Not Available | 625 | Open in IMG/M |
| 3300033980|Ga0334981_0116697 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300033992|Ga0334992_0183175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum → Rhizobium mesoamericanum STM3625 | 1053 | Open in IMG/M |
| 3300033992|Ga0334992_0265970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300033992|Ga0334992_0446000 | Not Available | 571 | Open in IMG/M |
| 3300033994|Ga0334996_0324144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300033994|Ga0334996_0474524 | Not Available | 567 | Open in IMG/M |
| 3300033994|Ga0334996_0526042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300033995|Ga0335003_0323055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300033996|Ga0334979_0218530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300034012|Ga0334986_0120072 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300034013|Ga0334991_0239870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300034020|Ga0335002_0466916 | Not Available | 683 | Open in IMG/M |
| 3300034020|Ga0335002_0489229 | Not Available | 660 | Open in IMG/M |
| 3300034022|Ga0335005_0616764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii → Acinetobacter baumannii NCGM 237 | 585 | Open in IMG/M |
| 3300034023|Ga0335021_0217744 | Not Available | 1056 | Open in IMG/M |
| 3300034061|Ga0334987_0542651 | Not Available | 699 | Open in IMG/M |
| 3300034062|Ga0334995_0000303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 53696 | Open in IMG/M |
| 3300034062|Ga0334995_0749437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → unclassified Thermoanaerobacterales → Thermoanaerobacterales bacterium 50_218 | 542 | Open in IMG/M |
| 3300034063|Ga0335000_0116003 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
| 3300034066|Ga0335019_0005309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED36 | 8721 | Open in IMG/M |
| 3300034066|Ga0335019_0014703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5384 | Open in IMG/M |
| 3300034066|Ga0335019_0049420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2882 | Open in IMG/M |
| 3300034066|Ga0335019_0159692 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300034068|Ga0334990_0046083 | Not Available | 2336 | Open in IMG/M |
| 3300034071|Ga0335028_0130143 | Not Available | 1620 | Open in IMG/M |
| 3300034071|Ga0335028_0318472 | Not Available | 916 | Open in IMG/M |
| 3300034071|Ga0335028_0552015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300034082|Ga0335020_0000405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33715 | Open in IMG/M |
| 3300034082|Ga0335020_0009682 | Not Available | 5848 | Open in IMG/M |
| 3300034082|Ga0335020_0021205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3669 | Open in IMG/M |
| 3300034082|Ga0335020_0055194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2082 | Open in IMG/M |
| 3300034082|Ga0335020_0162972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1122 | Open in IMG/M |
| 3300034082|Ga0335020_0171410 | Not Available | 1090 | Open in IMG/M |
| 3300034082|Ga0335020_0186844 | Not Available | 1038 | Open in IMG/M |
| 3300034082|Ga0335020_0414457 | Not Available | 647 | Open in IMG/M |
| 3300034082|Ga0335020_0591766 | Not Available | 519 | Open in IMG/M |
| 3300034082|Ga0335020_0615268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300034092|Ga0335010_0162424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
| 3300034093|Ga0335012_0063314 | Not Available | 2116 | Open in IMG/M |
| 3300034093|Ga0335012_0068380 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300034093|Ga0335012_0246986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum → Rhizobium mesoamericanum STM3625 | 926 | Open in IMG/M |
| 3300034093|Ga0335012_0491724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300034095|Ga0335022_0631942 | Not Available | 536 | Open in IMG/M |
| 3300034102|Ga0335029_0006286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9322 | Open in IMG/M |
| 3300034102|Ga0335029_0031528 | All Organisms → Viruses → Predicted Viral | 3980 | Open in IMG/M |
| 3300034102|Ga0335029_0150091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300034102|Ga0335029_0240677 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1176 | Open in IMG/M |
| 3300034103|Ga0335030_0100579 | Not Available | 2107 | Open in IMG/M |
| 3300034103|Ga0335030_0246460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
| 3300034103|Ga0335030_0816349 | Not Available | 545 | Open in IMG/M |
| 3300034104|Ga0335031_0003773 | Not Available | 11313 | Open in IMG/M |
| 3300034104|Ga0335031_0027274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I | 4174 | Open in IMG/M |
| 3300034104|Ga0335031_0052811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2927 | Open in IMG/M |
| 3300034104|Ga0335031_0625352 | Not Available | 631 | Open in IMG/M |
| 3300034104|Ga0335031_0740735 | Not Available | 558 | Open in IMG/M |
| 3300034105|Ga0335035_0466333 | Not Available | 699 | Open in IMG/M |
| 3300034106|Ga0335036_0016281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6039 | Open in IMG/M |
| 3300034106|Ga0335036_0291437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300034106|Ga0335036_0508200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I | 749 | Open in IMG/M |
| 3300034106|Ga0335036_0539453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300034109|Ga0335051_0083490 | Not Available | 1674 | Open in IMG/M |
| 3300034111|Ga0335063_0434394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300034111|Ga0335063_0486488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300034116|Ga0335068_0081508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1839 | Open in IMG/M |
| 3300034116|Ga0335068_0421707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034117|Ga0335033_0581688 | Not Available | 524 | Open in IMG/M |
| 3300034118|Ga0335053_0561838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300034118|Ga0335053_0758843 | Not Available | 540 | Open in IMG/M |
| 3300034120|Ga0335056_0687652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300034122|Ga0335060_0622648 | Not Available | 540 | Open in IMG/M |
| 3300034200|Ga0335065_0153923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300034272|Ga0335049_0406154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
| 3300034272|Ga0335049_0776860 | Not Available | 570 | Open in IMG/M |
| 3300034272|Ga0335049_0788896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300034279|Ga0335052_0203645 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1138 | Open in IMG/M |
| 3300034279|Ga0335052_0446927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 679 | Open in IMG/M |
| 3300034279|Ga0335052_0632755 | Not Available | 533 | Open in IMG/M |
| 3300034283|Ga0335007_0782123 | Not Available | 521 | Open in IMG/M |
| 3300034284|Ga0335013_0108050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1940 | Open in IMG/M |
| 3300034284|Ga0335013_0222107 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300034356|Ga0335048_0270529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum → Rhizobium mesoamericanum STM3625 | 896 | Open in IMG/M |
| 3300034356|Ga0335048_0330448 | Not Available | 779 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.37% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 5.63% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.05% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.45% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.02% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.73% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.15% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.15% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.15% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.72% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.43% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.43% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.43% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.29% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.29% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.29% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.29% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.29% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.29% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.29% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.29% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.29% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.14% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.14% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.14% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.14% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.14% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.14% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.14% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.14% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300002140 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002351 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004784 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300009387 | Microbial communities of water from Amazon river, Brazil - RCM24 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020734 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200056865 | 2199352004 | Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQQYGPRNVPFIPHTIPS |
| TBL_comb47_HYPODRAFT_1000382724 | 3300000553 | Freshwater | MYETTVRTPAGETKDRVFASNAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| JGI12421J11937_100322683 | 3300000756 | Freshwater And Sediment | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| B570J13884_1015427 | 3300001266 | Freshwater | MPMYETTVRTPQGDTKDKVFAPNVQEAKKLFEQKHGPRNVPYIPH |
| B570J14230_102137821 | 3300001282 | Freshwater | IMPMYETTVKTPQGETKDRVWAKDLQEARQLFEQRHGPRNVPYIPKIIPS* |
| Draft_100017312 | 3300001605 | Hydrocarbon Resource Environments | MPMYETTVRTSNGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKIVAS* |
| RCM40_10654811 | 3300001839 | Marine Plankton | MYETRVRTQKGEELKRVYAKDVQEAKRLFEQLYGGPRKVPYIPKVVPS* |
| RCM31_101201532 | 3300001851 | Marine Plankton | MYETRVRTDRGEELKRVYAKDVQEAKKLFEQLYGGPRKVPYIPHVVPS* |
| M2t2BS1_114120863 | 3300002131 | Marine | MPMYEATVRTPNGEEKKRVYADTPQEAKRLLEQLHGGPRAVPYIPHIVAS* |
| M2t2FKB2_123477049 | 3300002140 | Marine | MPMYEATVRTPNGEEKKRVYADTPQEAKKLLEQLHGGPRAVPYIPHIVAS* |
| M2t2BS2_110264666 | 3300002144 | Marine | MPMYEATVRTPSGEEKKRVYADTPQEAKQLLEQLHGGPRAVPYIPHIVAS* |
| JGI24766J26685_100717934 | 3300002161 | Freshwater And Sediment | MPMYETTVKTPQGEQKDRVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| metazooDRAFT_12128002 | 3300002195 | Lake | MYETTVRTPNGEVKDRVFASNAQEAKRLLEQRHGPRNVPYIPHVVAS* |
| B570J29582_100086315 | 3300002351 | Freshwater | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS* |
| B570J29032_1091505151 | 3300002408 | Freshwater | MPMYETTVKTPNGEKKDQVYAQNAKEAKQLFEQRYGPRNVPYIPHVIPS* |
| B570J29032_1093468163 | 3300002408 | Freshwater | TYTKTVQRLSMPMYETTVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| B570J29032_1094830483 | 3300002408 | Freshwater | MPMYETTVRTPQGETKDRVYASTVQEAKTLFEQRHGPRNVPYIPKIIPS* |
| B570J29032_1095606812 | 3300002408 | Freshwater | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQMYGGPRAVPYIPHIVPS* |
| JGI24768J34885_100043408 | 3300002447 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIAS* |
| JGI24768J34885_100131805 | 3300002447 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIFADTPQEAKKLFETLYGGPRAVPYIPHIIPS* |
| metazooDRAFT_107485222 | 3300002476 | Lake | MPMYETTVRTPEGERKDRVWARDLTEARQLFEQRHGPRNVPYIPHIIPS* |
| B570J40625_1000173463 | 3300002835 | Freshwater | MPLYETTVRTPNGDEKKRVYADTPQEAKKLFEQLYGGPRNVPYIPHVIPS* |
| B570J40625_10010677713 | 3300002835 | Freshwater | MPLYETTVKTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS* |
| B570J40625_10012493210 | 3300002835 | Freshwater | MPMYETTVRTPQGETKDRVYARDLQEARMLFEQRHGPRNVPYIPKIIPS* |
| B570J40625_1003400385 | 3300002835 | Freshwater | MPMYETTVKTPQGETKDRVWAKDLQEARQLFEQRHGPRNVPYIPKIIPS* |
| B570J40625_1006371163 | 3300002835 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLTEARMLFEQRHGPRNVPYIPKVIPS* |
| B570J40625_1006668192 | 3300002835 | Freshwater | MPMYETTVRTPAGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS* |
| B570J40625_1007374932 | 3300002835 | Freshwater | MPMYETTVRTPSGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS* |
| B570J40625_1010882623 | 3300002835 | Freshwater | MPMYETTVRTPQGETKDKVFAPNVQEAKKLFEQRHGPRNVPYLPHIIPS* |
| B570J40625_1012173492 | 3300002835 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPKIVAS* |
| JGI25921J50272_101159873 | 3300003430 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYADDVKEAKKLFEQLYGGPRAVPYIPHVVPS* |
| Ga0005853_10197141 | 3300003754 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0007850_10187572 | 3300003783 | Freshwater | MPMYETTVRTPTGEIRDRVYAANAQEAKKLLEQRHGPRNVPFIPHMIPS* |
| Ga0007879_10202584 | 3300003813 | Freshwater | PMYETEVRTPNGPVKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007829_100362611 | 3300004095 | Freshwater | PTKRAIRLMPMYETEVRTPNGTQKDRVYAQNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007829_101216002 | 3300004095 | Freshwater | MYETEVRTPNGPVKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0066181_101185642 | 3300004123 | Freshwater Lake | MPMFEATVRTPNGDTKERVWADNVQEAKQLLEQRFGPRNVPYIPHMIPH* |
| Ga0007787_100816851 | 3300004240 | Freshwater Lake | MPMYETTVRTPSGDTKDRVYAKDLTEAKQLFEQRHGPRNVPYIPKVIPS* |
| Ga0007787_101058014 | 3300004240 | Freshwater Lake | MPMYETTVKTTQGEVKDRVYAKDLQEAKQLFEQRHGPRNVPYIPKIIPS* |
| Ga0069718_138115361 | 3300004481 | Sediment | PQGETKDRVYAKDLQEARILFEQRHGPRNVPYIPKIIPS* |
| Ga0069718_155557742 | 3300004481 | Sediment | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVVPS* |
| Ga0065173_100001831 | 3300004686 | Freshwater | MPMYETEVRTPNGTQKDRVFAANAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0065173_10101311 | 3300004686 | Freshwater | MPMYETEVRTPTGPQKDRVYAKDAQEAKMIFEQRHGPRNVPYIPHMIPS* |
| Ga0065173_10217863 | 3300004686 | Freshwater | MYETTVRTPTGETKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0065173_10261692 | 3300004686 | Freshwater | MYETEVRTPVGTQKDRVFAASAQEAKRIFEQRHGPRNVPYIPHMIPS* |
| Ga0065171_10001882 | 3300004692 | Freshwater | MQHKLTAKVVGNMPMYETEVRTPNGTQKDRVFAANAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007804_10112967 | 3300004770 | Freshwater | MPMYETTVRTPTGETKDRVYASNAQEAKKLFEQRHGPRNVP |
| Ga0007804_10627391 | 3300004770 | Freshwater | MPMYETEVRTPNGTKKDRVYAANAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0007804_10963313 | 3300004770 | Freshwater | MYETTVRTPTGETKDREYASNAQEAKRLFEQRHGPRNVPYIPHM |
| Ga0007744_12458634 | 3300004784 | Freshwater Lake | MPMYETTVRTPQGEVKDRVYAETPQEAKQLFEQRHGPRNVPYIPKTIPS* |
| Ga0068876_1000001257 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGEVKDRVFAKDLQEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0068876_100182247 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGEIKDRVYANDPKEAKALFEQRHGPRNVPYIPKIIPS* |
| Ga0068876_1002209811 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGETKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKIIPS* |
| Ga0068876_100665912 | 3300005527 | Freshwater Lake | MPLYETTVRTPQGEEKKRIYATTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0068876_101778985 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGEEKKRVYADTPQEARKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0068876_103026482 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGDIKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0068876_103819261 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGEVKDRVYARDLTEARQLFEQRHGPRNVPYIPKIIPS* |
| Ga0068876_107589101 | 3300005527 | Freshwater Lake | TETNKEHCMPMYETTVKTPQGEEKKRLYANDVKEAKKLFEQLYGGPRAVPYIPHTVPS* |
| Ga0068876_107912554 | 3300005527 | Freshwater Lake | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVIPS* |
| Ga0068872_100340748 | 3300005528 | Freshwater Lake | TLSNKLLLNNFMPLYETTVRTPQGEEKKRIYATTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0068872_102533044 | 3300005528 | Freshwater Lake | PMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0068872_104020392 | 3300005528 | Freshwater Lake | MPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYVPHIIPS* |
| Ga0068872_106206081 | 3300005528 | Freshwater Lake | MPMFEATVRTPNGDNKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH* |
| Ga0049081_1000406510 | 3300005581 | Freshwater Lentic | MPMFEATVRTPNGDTKERVWADNVQEAKKLLEERFGPRNVPYLPHMIPH* |
| Ga0049081_1000556614 | 3300005581 | Freshwater Lentic | MPMYETTVRTPQGDTKDKVFAPNIQEAKKLFEQKHGPRNVPYIPHMIPS* |
| Ga0049081_100302222 | 3300005581 | Freshwater Lentic | MPMYETTVRTPQGEIKDKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0049081_100326482 | 3300005581 | Freshwater Lentic | MPLYEGTVRTAEGERKERVYADNPMEAKRLLEQLYGGPRAVPYIPHAIPS* |
| Ga0049081_100342768 | 3300005581 | Freshwater Lentic | MPMYETTVRTPQGDTKDRVYAPTVQEAKKLFEQRHGPRNVPYIPHVIPS* |
| Ga0049081_102634522 | 3300005581 | Freshwater Lentic | MPMYEATVRTPEGEKKDRVWAQDLAEARTLLEQRHGPRNVPYIPHIIPS* |
| Ga0049081_103358352 | 3300005581 | Freshwater Lentic | MPMFEATVRTSNGDTKERVYANNAQEAKQLLEERFGPRNVPYIPHMIPH* |
| Ga0049080_100731291 | 3300005582 | Freshwater Lentic | IMPMYEATVRTAEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0049080_102174913 | 3300005582 | Freshwater Lentic | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0049080_102311241 | 3300005582 | Freshwater Lentic | MPMYETTVKTPQGEEKKRLYANDVKEAKKLFEQLYGGPRAVPYIPHTVPS* |
| Ga0078894_100167139 | 3300005662 | Freshwater Lake | MPMYETTVKTPEGEKKDRVYASNAQEAKKLFEQRHGPRNVPYIPRIIPS* |
| Ga0078894_100240595 | 3300005662 | Freshwater Lake | MPMYETTVRTPQGEIKDRVYAQTLQEARMLFEQRHGPRNVPYIPKVVPS* |
| Ga0078894_100276604 | 3300005662 | Freshwater Lake | MPMYETTVRTPQGEEKKKIYAATPQEAKKLFEQLYGGPRAVPYIPHVVPS* |
| Ga0078894_101797804 | 3300005662 | Freshwater Lake | MPMYETEVRTPNGPTKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0078894_102988786 | 3300005662 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVIPS* |
| Ga0078894_103536541 | 3300005662 | Freshwater Lake | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQQYGPRNVPFIPHTIPS* |
| Ga0078894_104112423 | 3300005662 | Freshwater Lake | MPMYEATVRTPNGETKDRVFASTVQEAKQLLEQRHGPRNVPYIPHIIPS* |
| Ga0078894_104486576 | 3300005662 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRYGPRNVPYIPHMI |
| Ga0078894_105247385 | 3300005662 | Freshwater Lake | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0078894_105958454 | 3300005662 | Freshwater Lake | MPMYETTVRTPQGDTKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKIIPS* |
| Ga0078894_108232714 | 3300005662 | Freshwater Lake | MPMYETTVRTPSGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHTVPS* |
| Ga0078894_110569605 | 3300005662 | Freshwater Lake | MPMYEATVRTPQGETKDRVYAKDLTEAKQLFEQRHGPRNVPYVPKIIPS* |
| Ga0078894_110991502 | 3300005662 | Freshwater Lake | MPMYETTVRTPEGDKKDKVFAPNVQEAKKLFEQRHGPRNVPFIPHMVPS* |
| Ga0078894_112211262 | 3300005662 | Freshwater Lake | MPMYETTVRTPTGEIKDRVYAKDLQEARTLFAQRHGPRNVPYIPHIIPS* |
| Ga0078894_115941431 | 3300005662 | Freshwater Lake | MYETTVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIVPS* |
| Ga0078894_116128743 | 3300005662 | Freshwater Lake | HEHSSTCSKTDKRIIVPMYETTVRTPQGEQKDRVYAKNLQEARTLLEQRHGPRNVPYIPHIIPS* |
| Ga0079957_10157468 | 3300005805 | Lake | MYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIVPS* |
| Ga0079957_10172384 | 3300005805 | Lake | MPMFEATIRTPNGDTKERVWADNAQQAKKLLEERFGPRNVPYIPHMIPH* |
| Ga0079957_10192619 | 3300005805 | Lake | MPMYEATVRTPEGEKKEKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0079957_10253841 | 3300005805 | Lake | MPLYEATVRTQQGEEKKRVYADSVQEAKKLFEQLYGGPRAVPYLPKVVPS* |
| Ga0079957_103047510 | 3300005805 | Lake | MPMYETTVRTPQGDQKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS* |
| Ga0079957_10394739 | 3300005805 | Lake | MPMYETTVKTPQGEIKDRVYANTPQEAKRLFEQRHGPRNVPYIPKIIPS* |
| Ga0079957_11191112 | 3300005805 | Lake | MPMYETTVRTSQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0079957_12146071 | 3300005805 | Lake | PEGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0070743_1000148010 | 3300005941 | Estuarine | MYEATIRTPVGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0007876_10173812 | 3300006071 | Freshwater | MPMYETTVRTPAGDVKDRVYALNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007810_10180053 | 3300006101 | Freshwater | MPMYETEVRTPNGPVKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007870_10611241 | 3300006109 | Freshwater | MPMYETTVRTPAGDVKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007857_10335483 | 3300006112 | Freshwater | MPMYETTVRTPTGETKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007859_10656721 | 3300006118 | Freshwater | MPMYEATVRTPNGDTKERVYADNAQEAKKLLEQRFGPRNVPYIPHMIPH* |
| Ga0007805_10535262 | 3300006127 | Freshwater | MYETTVQTPNGETKDRVFAQNAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0007805_11184221 | 3300006127 | Freshwater | PNGTQKDRVFAANAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0070744_100419925 | 3300006484 | Estuarine | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRHGPRNVPYVPHIIPS* |
| Ga0070744_101104512 | 3300006484 | Estuarine | MYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0070744_101799734 | 3300006484 | Estuarine | MPMYETTVKTPEGEKKDKVYAQNAKEAKQLFEQRYGPRNVPYI |
| Ga0070744_102439583 | 3300006484 | Estuarine | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS* |
| Ga0075473_102673091 | 3300006875 | Aqueous | MPMYETTVRTPNGEVKDKVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0075460_102792963 | 3300007234 | Aqueous | MPLYETTVRTPNGEEKKQVYAENVQEARKLFEQLYGGPRRVPYIPHVIPS* |
| Ga0105050_100765195 | 3300007516 | Freshwater | MPMYEATVRTPNGEEKKRVYADTPQQAKRLLEQLHGGPRVVPYIPHIVAS* |
| Ga0099851_12107382 | 3300007538 | Aqueous | MPLYETTVRTPNGEEKKQVYAENVQEAKKLFEQLYGGPRRVPYIPHVIPS* |
| Ga0099846_11430451 | 3300007542 | Aqueous | MPLYETTVRTPNGEERKQVYAENVQEAKKLFEQLYGGPRRVPYIPHVIPS* |
| Ga0102819_10459424 | 3300007553 | Estuarine | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS* |
| Ga0102817_11002174 | 3300007555 | Estuarine | MYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPNIIPS* |
| Ga0102915_10215605 | 3300007562 | Estuarine | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPH |
| Ga0102863_11574923 | 3300007622 | Estuarine | MYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS* |
| Ga0102908_11301691 | 3300007665 | Estuarine | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRYGPRNVPYIPHMIPS |
| Ga0102859_11960041 | 3300007708 | Estuarine | MYETTVRTPAGEKKEKVFAPNVQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0105736_11159953 | 3300007861 | Estuary Water | MYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0099850_13848381 | 3300007960 | Aqueous | MPLYETTVRTPNGEEKKQVYAENVQEAKKLFEQLYGGPRRVPYIPH |
| Ga0105745_12988341 | 3300007972 | Estuary Water | YMPMYETTVRTPAGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS* |
| Ga0108970_104161621 | 3300008055 | Estuary | TTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKIVAS* |
| Ga0108970_104653955 | 3300008055 | Estuary | MPMYETTVKTPEGEKKDKVYAQNAKEAKQLFEQRYGPRNVPYIPHVIPS* |
| Ga0114340_100007043 | 3300008107 | Freshwater, Plankton | MPMYETTVRTSGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVVPS* |
| Ga0114340_100010153 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFESLYGGPRAVPYIPKVVPS* |
| Ga0114340_10003864 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFESLYGGPRAVPYIPKIVAS* |
| Ga0114340_100136218 | 3300008107 | Freshwater, Plankton | MYETTVRTPQGDTKDKVFAPNVQEAKKLFEQKHGPRNVPYIPHMIPS* |
| Ga0114340_100234915 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYAKDVKEAKQLFEQLYGGPRAVPYIPHVVPS* |
| Ga0114340_10036662 | 3300008107 | Freshwater, Plankton | MLPFLTSKEFIMPMYETTVRTPQGEIKDRVYANDPKEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0114340_10120329 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGDVKDRVYARDLKEARMLFEQRHGPRNVPYIPHVIPS* |
| Ga0114340_10147134 | 3300008107 | Freshwater, Plankton | LCLGGAKETLSNKLLLNNFMPLYETTVRTPQGEEKKRIYATTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114340_102770013 | 3300008107 | Freshwater, Plankton | MPMYETTVKTPNGDQKDRVYAPNLQEARKLFEQRHGPRNVPYIPHVVPS* |
| Ga0114340_10357811 | 3300008107 | Freshwater, Plankton | MPMYEATVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0114340_10366408 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114340_10941514 | 3300008107 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114340_11318733 | 3300008107 | Freshwater, Plankton | MYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVIPS* |
| Ga0114340_11447282 | 3300008107 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS* |
| Ga0114340_11550063 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYI |
| Ga0114340_12340553 | 3300008107 | Freshwater, Plankton | MPMYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114341_1000136719 | 3300008108 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPKIVAS* |
| Ga0114341_100037939 | 3300008108 | Freshwater, Plankton | MPMYETTVRTPTGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114341_100091585 | 3300008108 | Freshwater, Plankton | MPMYEATVRTPSGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114341_100314612 | 3300008108 | Freshwater, Plankton | MYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVIPS* |
| Ga0114341_102306775 | 3300008108 | Freshwater, Plankton | TPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114343_10251622 | 3300008110 | Freshwater, Plankton | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114344_10079804 | 3300008111 | Freshwater, Plankton | MYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS* |
| Ga0114344_101090912 | 3300008111 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHMVPS* |
| Ga0114344_11341497 | 3300008111 | Freshwater, Plankton | PMYETTVRTPTGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114346_10145066 | 3300008113 | Freshwater, Plankton | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS* |
| Ga0114346_102357511 | 3300008113 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHMVPS* |
| Ga0114346_11710563 | 3300008113 | Freshwater, Plankton | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRYGPRNVPYIPHMIPS* |
| Ga0114347_101020620 | 3300008114 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYADNVQEARKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114347_11089566 | 3300008114 | Freshwater, Plankton | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLY |
| Ga0114350_100269512 | 3300008116 | Freshwater, Plankton | MPMYETTVRTPSGDIKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS* |
| Ga0114350_10036205 | 3300008116 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS* |
| Ga0114350_100834327 | 3300008116 | Freshwater, Plankton | MYETTVRTPQGETKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKVIPS* |
| Ga0114350_10240477 | 3300008116 | Freshwater, Plankton | MPMYETTVRTPPGEEKKRIYADNMQEARKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114350_10635722 | 3300008116 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQMYGGPRAVPYIPHIIPS* |
| Ga0114350_11073665 | 3300008116 | Freshwater, Plankton | MYETTVKTAQGEVKDRVYAKDLQEAKQLFEQRHGPRNVPYITK |
| Ga0114350_11765763 | 3300008116 | Freshwater, Plankton | MPMYEATVRTPSGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYKPHIVPS* |
| Ga0114351_13333553 | 3300008117 | Freshwater, Plankton | EGRRFESCISDHYKEHIMPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKIVPS* |
| Ga0114351_14138784 | 3300008117 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114355_100694716 | 3300008120 | Freshwater, Plankton | TTVRTPQGEIKDKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0114355_11404195 | 3300008120 | Freshwater, Plankton | MPMYETNVRTPQGEEKKRIYADNVQEARKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114355_12561445 | 3300008120 | Freshwater, Plankton | MPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVP |
| Ga0114841_12636043 | 3300008259 | Freshwater, Plankton | VRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114336_100095610 | 3300008261 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114337_10161485 | 3300008262 | Freshwater, Plankton | MPMYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVIPS* |
| Ga0114337_10798995 | 3300008262 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVP |
| Ga0114337_11087955 | 3300008262 | Freshwater, Plankton | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0114363_10009022 | 3300008266 | Freshwater, Plankton | MLPFLTSKEFIMPMYETTVRTPQGEIKDRVYANDPKEAKALFEQRHGPRNVPYIPKIIPSG* |
| Ga0114364_10228764 | 3300008267 | Freshwater, Plankton | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS* |
| Ga0114364_10938923 | 3300008267 | Freshwater, Plankton | MPMYETTVRTPQGDTKDKVFAPNVQEAKKLFEQKHGPRNVPYIPHMIPS* |
| Ga0114364_11466762 | 3300008267 | Freshwater, Plankton | MYETTVRTPEGEKKDRVWARDLAEARTLLEQRHGPRNVPYIPHIVPS* |
| Ga0114364_11966981 | 3300008267 | Freshwater, Plankton | MYETTVRTPQGEEKKRIYAATPQEAKKLFEQQYGGPRAVPYIPHIIPS* |
| Ga0114876_11194925 | 3300008448 | Freshwater Lake | MPMYETTVRTPQGDTKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS* |
| Ga0114880_12222042 | 3300008450 | Freshwater Lake | MPMFEATVRTPNGDTKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH* |
| Ga0104242_10216392 | 3300008962 | Freshwater | MPMYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0102816_10569865 | 3300008999 | Estuarine | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHLIPS* |
| Ga0102829_11556571 | 3300009026 | Estuarine | MYETTVRTPQGEKKEKVFAPNVQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0102829_13221341 | 3300009026 | Estuarine | TVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAI* |
| Ga0102830_10219293 | 3300009059 | Estuarine | MPMYEATIRTPVGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0114973_1000015023 | 3300009068 | Freshwater Lake | MPMYETTVRTPTGETKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0114973_1000570310 | 3300009068 | Freshwater Lake | MYETTVRTPTGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0114962_100240553 | 3300009151 | Freshwater Lake | MYETEVRTPNGPTKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0114962_105424652 | 3300009151 | Freshwater Lake | MPMYETTVRTPTGETKDRVFAPNIQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0114980_101182007 | 3300009152 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0114980_101456135 | 3300009152 | Freshwater Lake | YETTVRTPTGEIKDRVYAKDLQEARTLFAQRHGPRNVPYIPHIIPS* |
| Ga0114980_104850512 | 3300009152 | Freshwater Lake | MPLYEATVRTPQGEEKKQVWANNSQEARRLFEQMYGGPRAVPYLPRVIPS* |
| Ga0114963_103700313 | 3300009154 | Freshwater Lake | IMPMYETTVRTPTGETKDRVFAPNIQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0114968_101407314 | 3300009155 | Freshwater Lake | MYETTVRTSAGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0114977_1001507610 | 3300009158 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVPYIPHIIPS* |
| Ga0114977_106457192 | 3300009158 | Freshwater Lake | MYETTVRTPTGEIKDHVFAPTAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0114978_1000212210 | 3300009159 | Freshwater Lake | MPMYETTVKTPTGETKDRVFAPNAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0114978_100023789 | 3300009159 | Freshwater Lake | MPMYETTVRTPTGEIKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0114978_103258193 | 3300009159 | Freshwater Lake | MPLYEATVRTPQGEEKKQIWADTPQEARRLFEQMYGGPRAVPYLPRVIPS* |
| Ga0114978_103339036 | 3300009159 | Freshwater Lake | MPMYETTVRTPEGEKKEKVFAPNVQEAKKLFEQKYGPRNVPFIPHTIPS* |
| Ga0114981_105883512 | 3300009160 | Freshwater Lake | MYETTVKTPTGETKDRVFAPNAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0114970_107328594 | 3300009163 | Freshwater Lake | MYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0105097_100267353 | 3300009169 | Freshwater Sediment | MPMYETTVRTPQGEEKKRIYADDVKEAKKLFEQLYGGPRAVPYIPHTIPS* |
| Ga0114959_100463452 | 3300009182 | Freshwater Lake | MPMYETTVPTPTGETKDRVFAPNIQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0114974_1000637213 | 3300009183 | Freshwater Lake | MPMYETTVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0114974_103286452 | 3300009183 | Freshwater Lake | MPMYETTVRTPEGERKDRVYAKDLHEARTLFEQRHGPRNVPYIPHIIPS* |
| Ga0114974_104814402 | 3300009183 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQQYGGYVDQTDLD* |
| Ga0114974_106187961 | 3300009183 | Freshwater Lake | MYETTVKTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0114974_106856881 | 3300009183 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRHGPRNVPYIPHVIPS* |
| Ga0114974_107644982 | 3300009183 | Freshwater Lake | MYETTVRTPEGEKKEKVFAPNVQEAKKLFEQKYGPRNVPFIPHTIPS* |
| Ga0114976_100125927 | 3300009184 | Freshwater Lake | MYETTVRTPTGEIKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0114976_103177872 | 3300009184 | Freshwater Lake | MPMYETTVRTPEGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS* |
| Ga0114976_104044272 | 3300009184 | Freshwater Lake | MAMYETTVKTPEGEKKERVYANNAQEAKQLLEQRFGPRNVPYIPHMIPH* |
| Ga0114971_105708013 | 3300009185 | Freshwater Lake | MYETTVRTPTGETKDRVFAPNAQEAKKLLEQRHGPRNV |
| Ga0114983_10374563 | 3300009194 | Deep Subsurface | MPMYETTVRTSNGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0103869_101333502 | 3300009257 | River Water | MPMYETTVRTPQGEEKKRIYADTPQEAKRLFEQLYGGPRNVPYIPHVIPS* |
| Ga0103871_10117992 | 3300009387 | River Water | MYETTVKTAEGEKKVRVYAPDVKEAKKLFESLYGGPRNVPYIPHVVPS* |
| Ga0103871_10220564 | 3300009387 | River Water | MPLYETTVRTPQGDQKKQVYADTPQEAKKIFEQLYGGPRNVPYIPHIKPS* |
| Ga0114982_100000472 | 3300009419 | Deep Subsurface | MPMYEAVVRTPEGEKKQRVWAPDMKTARHLLEQEYGIKNVPYQPKIVPN* |
| Ga0114982_100963210 | 3300009419 | Deep Subsurface | MYETTVKTPSGEQKERVYAPDAQEAKKLLEQRFGPRNVPYIPHMVPH* |
| Ga0114982_10376553 | 3300009419 | Deep Subsurface | MPMYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPRIIPS* |
| Ga0114982_10952894 | 3300009419 | Deep Subsurface | MPMYETTVKTPEGEKKDRVYAQNAKEAKQLFEQRYGPRNVPYIPHVIPS* |
| Ga0115554_13116801 | 3300009472 | Pelagic Marine | MYETTVRTPTGEEKKRVYADTPQEAKRLLEQLHGGPRAVPYIPHVVP |
| Ga0114951_1000825315 | 3300009502 | Freshwater | YETTVRTPNGETRDRVYAVNAQEAKKLFKQRHGPRNVPYIPHMIPS* |
| Ga0114951_100296953 | 3300009502 | Freshwater | MYETTVRTPTGETKDRVYASNAQEAKRLFEQRHGPRNVPYIPHMIPS* |
| Ga0115567_101050616 | 3300009508 | Pelagic Marine | MPMYETTVRTPTGEEKKRVYADTPQEAKRLLEQLHGGPRAVPYIPHVVPS* |
| Ga0114964_100023694 | 3300010157 | Freshwater Lake | MPMYETTVKTSAGETKDRVFAPTAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0114960_105788852 | 3300010158 | Freshwater Lake | MYETTVRTPTGETKDRVFAPNIQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0114967_101753452 | 3300010160 | Freshwater Lake | MPMYETTVRTSAGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0129351_12617503 | 3300010300 | Freshwater To Marine Saline Gradient | MPLYETTVRTPNGEEQKQVYAENVQEAKKLFEQLYGGPRRVPYIPHVIPS* |
| Ga0136644_107031351 | 3300010334 | Freshwater Lake | QRISMPMYETEVRTPNGPTKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0129333_1000003435 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGEEKKRVYAKDVKEAKQLFEQLYGGPRAVPYIPHIVPS* |
| Ga0129333_100012639 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVKTPQGEEKKRIYAENVQEAKKLFEQLYGGPRAVPYIPKVVAS* |
| Ga0129333_100021713 | 3300010354 | Freshwater To Marine Saline Gradient | MPLFETKVKTPQGEEKKQIYAKDAQEAKKLFEQLYGGPRNVPYLPHMIPS* |
| Ga0129333_1000318211 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKIIPS* |
| Ga0129333_100056614 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGDTKDRVYAKDLQEARQLFEQRHGPRNVPYIPKVIPS* |
| Ga0129333_1002166510 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVPYIPHVIPS* |
| Ga0129333_100217318 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGEEKKRIYANDVKEAKKLFEQLYGGPRAVPYVPKVVPS* |
| Ga0129333_1002893425 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVKTSNGEEKKQVYAKDSSEAKRLFEQLYGSPRAVPYIPKIIPS* |
| Ga0129333_100629706 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS* |
| Ga0129333_100650064 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGDTKDRVYAKDLQEAKQLFEQRHGPRNVPFVPKIIPS* |
| Ga0129333_1006913010 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGDVKDRVYAKDLAEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0129333_1008642110 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGEEKKRIYADTAQEAKKLFEQMYGGPRAVPYIPKIIPS* |
| Ga0129333_101051434 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGETKDRVWAKDVTEAKQLFEQRHGPRNVPFVPKIIPH* |
| Ga0129333_101499424 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVRTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS* |
| Ga0129333_101685865 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVRTPQGEEKKQVYANTPQEAKKLFEQLYGGPRAVPYLPKVIPS* |
| Ga0129333_102202393 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGETKDRVYAKDLQEARMLFEQRHGPRNVPYIPKIIPS* |
| Ga0129333_102522162 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYEATVRTPQGDTKDRVYAKDLQEARQLFEQRHGPRNIPYIPKVIPS* |
| Ga0129333_102576233 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYVPHIVPS* |
| Ga0129333_103382735 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGDTKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0129333_103547694 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGEEKKRVFADSPQEAKKLFEQLYGGPRAVPYVPKIVAS* |
| Ga0129333_104393452 | 3300010354 | Freshwater To Marine Saline Gradient | MYETRVRTDKGEETKRVFAKDVQEAKKLFEQLYGGPRKVPYIPHTVPS* |
| Ga0129333_105462355 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVRTPEGEVKKQVYAKDVSEAKRLFEQLYGGPRAVPYIPKVIPS* |
| Ga0129333_107393022 | 3300010354 | Freshwater To Marine Saline Gradient | MYETTVRTPQGDQKDRVFANTPQEAKQLFEQRYGPRNVPYIPKIIPS* |
| Ga0129333_109254472 | 3300010354 | Freshwater To Marine Saline Gradient | MGQQCKEIAMPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYVPHIIPS* |
| Ga0129333_110079033 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVRTPQGEEKKQVYADTPQEAKKLFEQLYGGPRAVPYLPKVIPS* |
| Ga0129333_111582361 | 3300010354 | Freshwater To Marine Saline Gradient | MYETRVRTPQGEETKRIYAKDAQEAKKLFEQLYGGPRKVPYIPHMVPS* |
| Ga0129333_113982342 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGETKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0129333_114112431 | 3300010354 | Freshwater To Marine Saline Gradient | MPLYETTVKTAQGEEKKQIYARDAAEAKRLFEQMYGGPRAVPYLPKIIPG* |
| Ga0129333_114603612 | 3300010354 | Freshwater To Marine Saline Gradient | TPQGEEKKRVYADTPQEAKKLFEQMYGGPRAVPYIPKVVPS* |
| Ga0129333_114603762 | 3300010354 | Freshwater To Marine Saline Gradient | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVVPS* |
| Ga0116237_103853213 | 3300010356 | Anaerobic Digestor Sludge | MYEATVRTPQGDTKDRVYAKDLTEAKQLLEQRHGPRNVPYVPKIIPS* |
| Ga0129336_100245525 | 3300010370 | Freshwater To Marine Saline Gradient | VFLYGLEITMPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVVPS* |
| Ga0129336_101488225 | 3300010370 | Freshwater To Marine Saline Gradient | VRTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMMPS* |
| Ga0129336_102997821 | 3300010370 | Freshwater To Marine Saline Gradient | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAV |
| Ga0129336_103349921 | 3300010370 | Freshwater To Marine Saline Gradient | RTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS* |
| Ga0114986_10520762 | 3300010374 | Deep Subsurface | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0133913_1000871914 | 3300010885 | Freshwater Lake | MPMYETTVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIVPS* |
| Ga0133913_100947499 | 3300010885 | Freshwater Lake | MYETTVRTPTGEIKDRVFAPTAQEAKKLFEQRHGPRNVPYVPHMIPS* |
| Ga0133913_104312146 | 3300010885 | Freshwater Lake | MYETTVRTPEGERKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIVPS* |
| Ga0133913_104529742 | 3300010885 | Freshwater Lake | MPMYETTVRTPEGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0133913_105182594 | 3300010885 | Freshwater Lake | MYETTVRTPAGETKDRVYAPNAQEAKKLFEQRHGPRNVPYIPHMVPS* |
| Ga0133913_105602864 | 3300010885 | Freshwater Lake | MPMYETTVKTPEGEKKERVYANNAQEAKQLLEQRFGPRNVPYIPHMIPH* |
| Ga0133913_119358913 | 3300010885 | Freshwater Lake | MYETTVRTPAGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS* |
| Ga0133913_122558631 | 3300010885 | Freshwater Lake | MPMYETTVRTPTGETKDQVFAPNAQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0133913_129833042 | 3300010885 | Freshwater Lake | MPMYETTVKTPNGDTKERVYADNAQEAKKLLEQRFGPRNVPYIPHMIPH* |
| Ga0133913_133233127 | 3300010885 | Freshwater Lake | YETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS* |
| Ga0139557_100176416 | 3300011010 | Freshwater | MKMPMYETTVRTPQGEVKDRVYAETPQEAKQLFEQRHGPRNVPYIPKTIPS* |
| Ga0139556_10568682 | 3300011011 | Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHMIPS* |
| Ga0151517_100229 | 3300011113 | Freshwater | MPMYETTVRTPEGERKDRVWARDLVEARMLLEQRHGPRNVPYIPHIVPS* |
| Ga0136709_10164241 | 3300011184 | Freshwater | MPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIIPS* |
| Ga0136709_10315303 | 3300011184 | Freshwater | MPMYETTVRTPSGEEKKRVYAATPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0136709_10421952 | 3300011184 | Freshwater | MPMYETTVRTPQGETKDRVYAKTVQEAKALFEQRHGPRNVPYIPKIIPS* |
| Ga0151620_12597873 | 3300011268 | Freshwater | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHMIPS* |
| Ga0157138_10805382 | 3300012352 | Freshwater | MPMYETTVRTPQGETKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS* |
| Ga0157203_10298061 | 3300012663 | Freshwater | MPMYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0157203_10350523 | 3300012663 | Freshwater | MPMYETTVRTPQGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0157210_10006156 | 3300012665 | Freshwater | MPMYETTVRSPQGESKDRVYAKDLNEAKKLFEQRHGPRNVPYVPKIIPS* |
| Ga0157210_10010649 | 3300012665 | Freshwater | MPMYEATVRTPTGEEKKRIFADTPQEAKKLFEQLYGGPRAVPYIPHIVAS* |
| Ga0164293_1000052731 | 3300013004 | Freshwater | VSSNLTRGAKLKKGIIMPMYETTVRTSGGEEKKRIFADTPQEAKKLFEQLYGGPRAVPYIPKIVPS* |
| Ga0164293_100324335 | 3300013004 | Freshwater | MPMYETTVRTPQGETKDRVYAKTVQEAKVLFEQRHGPRNVPYIPKIIPS* |
| Ga0164293_1015710911 | 3300013004 | Freshwater | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHMVPS* |
| Ga0164293_101760362 | 3300013004 | Freshwater | MYEATVRTPQGEQKDRVWAQDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0164293_102068626 | 3300013004 | Freshwater | MYETTVRTPQGETKDRVYAKTLQEAKALFEQRHGPRNVPYIPKIIPS* |
| Ga0164293_104245013 | 3300013004 | Freshwater | MYETTVRTPQGDTKDRVYAKDLQEAKQLFEQRHGPRNVPYIPKVIP |
| Ga0164293_104721242 | 3300013004 | Freshwater | MPMYETTVRTPQGEEKKRIYAQDVKEAKKLFEQLYGGPRAVPYIPHMVPS* |
| Ga0164293_105636004 | 3300013004 | Freshwater | MPMYETTVRTPQGDTKDKVYAPNVQEAKKLFEQKHGPRNVPYIPHMIPS* |
| Ga0164293_105756742 | 3300013004 | Freshwater | MDQQCKEIAMPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIIPS* |
| Ga0164292_101539047 | 3300013005 | Freshwater | MPMYETTVRTPEGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS* |
| Ga0164292_103678784 | 3300013005 | Freshwater | MPMYETTVRTLQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS* |
| Ga0164292_105164482 | 3300013005 | Freshwater | MYETTVRTPQGDTKDKVYAPNVQEAKKLFEQKHGPRNVPYIPHMIPS* |
| Ga0164292_107441572 | 3300013005 | Freshwater | MYETTVRTPGGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIVPS* |
| Ga0164294_101144665 | 3300013006 | Freshwater | MYEATVRTPEGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS* |
| Ga0164294_104523982 | 3300013006 | Freshwater | MPMYETTVRTPEGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHLIPS* |
| Ga0163212_11135253 | 3300013087 | Freshwater | VCFHMVKEIDMPMYETTVRTPQGDTKDRVYARDLQEARMLFEQRHGPRNVPYIPHVVPS* |
| Ga0164296_10556174 | 3300013093 | Freshwater | MPMYETEVRTPTGTQKDRVFAANAQEAKRLLEQRHGPRNVPYIPHMIPS* |
| Ga0164297_100250056 | 3300013094 | Freshwater | MYETTVRTPEGEKKDRVWANSAHDAKKLFEQRHGPRNVPYIPHMIPS* |
| (restricted) Ga0172367_101617611 | 3300013126 | Freshwater | MPMYETTVRTPSGDQKDRVYARDLQEARVLFEQRHGPRNVPYIPKVIPS* |
| Ga0181363_10248502 | 3300017707 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHVVPS |
| Ga0181363_10650113 | 3300017707 | Freshwater Lake | GYYMPMYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0181350_10078508 | 3300017716 | Freshwater Lake | MPMYEATIRTPTGETKDRVYAANAQEAKHLLEQRHGPRNVPYIPHVIPS |
| Ga0181350_10325328 | 3300017716 | Freshwater Lake | MYETTVRTPQGEEKKKIYAATPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0181347_10441334 | 3300017722 | Freshwater Lake | MPMYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0181347_11336324 | 3300017722 | Freshwater Lake | MPMYETTVKTPEGEKKDKVYAQSAKEAKQLFEQRYGPRNVPYIPHMIAS |
| Ga0181362_10094645 | 3300017723 | Freshwater Lake | MYEATVRTPQGEQKDRVWARDLTEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0181352_10939133 | 3300017747 | Freshwater Lake | MYETTVKTPEGEKKDRVYASNAQEAKKLFEQRHGPRNVPYIPRIIPS |
| Ga0181352_11383512 | 3300017747 | Freshwater Lake | MPMYETTVRTPQGDTKDKVFAPNIQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0181352_11481371 | 3300017747 | Freshwater Lake | MPMYEATVRTPEGEKKEKVFAPNVQEAKKLLEQRHGPRNVPY |
| Ga0181344_10254292 | 3300017754 | Freshwater Lake | MYEATVRTPNGETKDRVFASTVQEAKQLLEQRHGPRNVPYIPHIIPS |
| Ga0181344_11421552 | 3300017754 | Freshwater Lake | MPMYETTVRTPEGERKDRVYAKDLQEARQLFEQRHGPRNVPYIPHIIPS |
| Ga0181356_11257381 | 3300017761 | Freshwater Lake | MYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPIAVPYIPHIIPS |
| Ga0181343_10527205 | 3300017766 | Freshwater Lake | MPMYETTVRTPQGDTKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKIIPS |
| Ga0181343_10880604 | 3300017766 | Freshwater Lake | SIWSKESAMPMYETTVRTPSGDTKDRVYAKDLQEARVLFEQRHGPRNVPYIPKVIPS |
| Ga0181343_11290603 | 3300017766 | Freshwater Lake | MPMYETTVKTPEGEKKDRVYASNAQEAKKLFEQRHGPRNVPYIPRIIPS |
| Ga0181343_11330691 | 3300017766 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVVPS |
| Ga0181343_11950802 | 3300017766 | Freshwater Lake | MPMYETTVRTPTGEIKDRVYAKDLQEARTLFAQRYGPRNVPYIPHIIPS |
| Ga0181358_11895832 | 3300017774 | Freshwater Lake | MYEATVRTPEGEKKDRVWAKDLAEARTLLEQRHGPRNVPFIPHIIPS |
| Ga0181357_10340851 | 3300017777 | Freshwater Lake | KIKFTHGAPCFKEICMPMYETTVKTPEGEKKDKVYAQSAKEAKQLFEQRYGPRNVPYIPHVIAS |
| Ga0181349_10099407 | 3300017778 | Freshwater Lake | MYETTVRTPEGEKKDRVWARDLAEARTLLEQRHGPRNVPYIPHIVPS |
| Ga0181349_10339455 | 3300017778 | Freshwater Lake | MYETTVRTPQGERKDHVWARDLAEARMLPEQRHGPRNVPYIPHIIPS |
| Ga0181349_10569984 | 3300017778 | Freshwater Lake | MPMYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIP |
| Ga0181349_11253172 | 3300017778 | Freshwater Lake | MPMYETTVRTPQGEEKKKIYASTPQEAKKLFEQLYGGPRAVPYIPHIIPG |
| Ga0181349_12353062 | 3300017778 | Freshwater Lake | MMPMYEATVRTPEGERKDRVWARDLAEARTLLEQRHGPRNVPYIPHIIPS |
| Ga0181348_12477041 | 3300017784 | Freshwater Lake | MPMYETTVKTPEGEKKDRVYAQNAKEAKQLFEQRYGPRNVPYIPHVIAS |
| Ga0181355_11495701 | 3300017785 | Freshwater Lake | MPMYEKTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0181355_12522042 | 3300017785 | Freshwater Lake | MYETTVKTPEGEKKDKVYAQSAKEAKQLFEQRYGPRNVPYIPHVIAS |
| Ga0169931_1000372728 | 3300017788 | Freshwater | MPMYETTVRTAGGEEKKRIFADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0169931_1008668615 | 3300017788 | Freshwater | MPMYEATIRTSQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHVVPN |
| Ga0181563_107392131 | 3300018420 | Salt Marsh | ATVRTPQGEEKKRIFADTPQEAKKLFEQLYGGPRKVPYIPHVVPS |
| Ga0187843_100085298 | 3300019093 | Freshwater | MYETTVRTPAGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0187843_102704543 | 3300019093 | Freshwater | MPMYETTVRTPSGEEKKRIYASTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0188839_100182410 | 3300019122 | Freshwater Lake | MYNYKGTIMPMYETTVRTPQGEEKKRIFADTPQEAKKLFEQLYGGPRKVPYIPHVVPS |
| Ga0188839_10086052 | 3300019122 | Freshwater Lake | MPMYETTVRTPQGEEKKRIFADTPQEAKKLFEQLYGGPRKVPYIPHVVPS |
| Ga0181359_10193534 | 3300019784 | Freshwater Lake | MYEATVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0181359_10762124 | 3300019784 | Freshwater Lake | MPMYEATVRTPEGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0194113_105763545 | 3300020074 | Freshwater Lake | MPMYETTVRTPQGDTKDRVYAKDLQEARVLFEQRHGPRNVPYIPKVIPS |
| Ga0211732_11304841 | 3300020141 | Freshwater | MPMYETTVRTPQGDTKDKVFAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0211732_12503386 | 3300020141 | Freshwater | MPLYEGTVRTAEGERKERVYADNPMEAKRLLEQLYGGPRAVPYIPHAIPS |
| Ga0211732_14094824 | 3300020141 | Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0211732_15349804 | 3300020141 | Freshwater | MYETTVKTPQGEEKKKIYADTPQEAKKLFEQLYGGPRAVPFIPHIVPS |
| Ga0211732_15606763 | 3300020141 | Freshwater | MPMYETTVRTPEGEKKDRVYAPNVQEAKKLFEQRHGPRAVPYIPHVVPS |
| Ga0211732_15670742 | 3300020141 | Freshwater | MPMYETTVRTPQGDEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0211736_100116516 | 3300020151 | Freshwater | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0211736_101003342 | 3300020151 | Freshwater | MPMYETTVKTPQGETKDRVYAKTVQEAKTLFEQRHGPRNVPYIPKIIPS |
| Ga0211736_101994981 | 3300020151 | Freshwater | MYEATVRTPEREQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0211736_103101743 | 3300020151 | Freshwater | MYEATVRTPAGEKKDRVWARDLVEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0211736_104189953 | 3300020151 | Freshwater | MPMYETTVRTPQGETKDRVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0211736_104944182 | 3300020151 | Freshwater | MPMYETTVKTPSGEKKDRVYAQTVQEAKKLFEQRYGPRNVPYIPHMIAS |
| Ga0211736_105081983 | 3300020151 | Freshwater | PMYETTVRTPQGEEKKRVYADTPQEAKKLFEQMYGGPRAVPYIPHIIPS |
| Ga0211736_105234201 | 3300020151 | Freshwater | MPMYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0211736_107375392 | 3300020151 | Freshwater | MPMYETTVKTPEGEKKERVYANNAQEAKQLLEQRFGPRNVPYIPHTVPH |
| Ga0211736_1098376212 | 3300020151 | Freshwater | MPMYETTVKTPKGEKKDQVYAQNAKEAKQLFEQRYGPRNVPYIPHIIAS |
| Ga0211734_100191045 | 3300020159 | Freshwater | MYEATVRTPVGEKKDRVWARDLVEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0211734_102227222 | 3300020159 | Freshwater | MPMFEATVRTPNGDTKERVWADNVQEAKQLLEQRFGPRNVPYIPHMIPH |
| Ga0211734_103642648 | 3300020159 | Freshwater | MPMYETTVRTPQGEIKDRVYAQTLQEARMLFEQRHGPRNVPYIPKVVPS |
| Ga0211734_107516668 | 3300020159 | Freshwater | MPMYETTVRTPQGDTKDRVYAKDLQEARMLFEQRHGPRNVPYIPKIIPS |
| Ga0211734_1115946226 | 3300020159 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPFIPHIVPS |
| Ga0211733_103307906 | 3300020160 | Freshwater | YMPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQQYGGPRAVPYIPHIIPS |
| Ga0211733_109090302 | 3300020160 | Freshwater | MPMYETTVRTPEGEQKKKIYADTPQEAKKLFEQLYGGPRAVPFIPHIVPS |
| Ga0211733_109357101 | 3300020160 | Freshwater | IMPMYETTVRTPEGERKDRVYAKDLQEARTLFEQRHGPRNVPFIPHIVPS |
| Ga0211726_100457681 | 3300020161 | Freshwater | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQMYGGPRAVPYIPHIIPS |
| Ga0211726_103143781 | 3300020161 | Freshwater | RTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0211726_103496146 | 3300020161 | Freshwater | MPMYETTVRTPQGETKDRVYAQTLQEARMLFEQRHGPRNVPYIPKVVPS |
| Ga0211726_103815104 | 3300020161 | Freshwater | MAMGQQCKEIAMPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYVPHIIPS |
| Ga0211726_104898101 | 3300020161 | Freshwater | MPMYETTVRTPQGDTKDRVYAKDLQEARMLFEQRHGPRNVLYIPHVVPS |
| Ga0211726_106685074 | 3300020161 | Freshwater | MPMFEATVRTPNGDTKERVYANNAQEAKQLLEQRFGPRNVPYIPHMIPH |
| Ga0211726_106857432 | 3300020161 | Freshwater | MPMYETTVRTPEGEKKDRVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0211726_1080847619 | 3300020161 | Freshwater | MYETTVRTPEGERKDRVYAKDLQEARTLFEQRHGPRNVPFIPHIVPS |
| Ga0211726_108133611 | 3300020161 | Freshwater | MPMYETTVRTPEGEQKKKIYADTPQEAKKLFEQLYGGPRAVPF |
| Ga0211726_11041567102 | 3300020161 | Freshwater | MPMYETTVRTPQGEEKKRIYADTQQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0211735_102551706 | 3300020162 | Freshwater | MPMYETTVRTPEGERKDRVWAKDLTEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0211735_104245724 | 3300020162 | Freshwater | SKTKQRLILPMYEATVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0211735_106950973 | 3300020162 | Freshwater | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLLEQRHGPRNVPYIPHII |
| Ga0211735_114869413 | 3300020162 | Freshwater | MPMYETTVKTPEGEKKDRVYAQNIKEAKQLFEQRYGPRNVPYIPHMIAS |
| Ga0206128_100248310 | 3300020166 | Seawater | MYETTVRTPTGEEKKRVYADTPQEAKRLLEQLHGGPRAVPYIPHVVPS |
| Ga0211729_103318713 | 3300020172 | Freshwater | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0211729_103520896 | 3300020172 | Freshwater | MYEATVRTPQGEQKDRVWARDLAEARILLEQRHGPRNVPYIPHIVPS |
| Ga0211729_106761741 | 3300020172 | Freshwater | MPMYEATVRTPEGEKKDRVYAKGLQEARQLLEQRHGPRNVPYVPHIIPS |
| Ga0211729_106915202 | 3300020172 | Freshwater | MPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIP |
| Ga0211729_114087365 | 3300020172 | Freshwater | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0194115_102695541 | 3300020183 | Freshwater Lake | MYETTVRTPQGDTKDRVYAKDLQEARVLFEQRHGPRNVPYIPKVIPS |
| Ga0206130_100266019 | 3300020187 | Seawater | MPMYETTVRTPTGEEKKRVYADTPQEAKRLLEQLHGGPRAVPYIPHVVPS |
| Ga0194121_101982376 | 3300020200 | Freshwater Lake | ETTVRTPQGDTKDRVYAKDLQEARVLFEQRHGPRNVPYIPKVIPS |
| Ga0211731_101476775 | 3300020205 | Freshwater | MPMYETTVRTPEGERKDRVWAKDLTEARMLLEQRHGPRNVPYIP |
| Ga0211731_102947434 | 3300020205 | Freshwater | MPMYETTVKTPEGEKKDRVYAQNAKEAKQLFEQRYGPRNVPYIPHVIPS |
| Ga0211731_1065969010 | 3300020205 | Freshwater | MPMYEATVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0211731_106600653 | 3300020205 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPHVVSS |
| Ga0211731_109265701 | 3300020205 | Freshwater | PQGEEKKRIYAATPQEAKKLFEQQYGGPRAVPYIPHIIPS |
| Ga0211731_112660802 | 3300020205 | Freshwater | MPMYETTVKTPNGEKKDQVYAQNAKEAKQLFEQRYGPRNVPYIPHMIAS |
| Ga0211731_113473518 | 3300020205 | Freshwater | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0211731_113774925 | 3300020205 | Freshwater | MPMYEATVRTPAGEKKDRVWARDLVEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0211731_114388712 | 3300020205 | Freshwater | MYETTVRTPEGEKKDRVWARDLAEARILLEQRHGPRNVPYIPHIVPS |
| Ga0211731_114686488 | 3300020205 | Freshwater | MPMYETTVRTPEGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0208202_100263211 | 3300020514 | Freshwater | MPLYETTVRTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS |
| Ga0208232_10030412 | 3300020527 | Freshwater | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS |
| Ga0208224_10074579 | 3300020528 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPKIVAS |
| Ga0214235_10635311 | 3300020734 | Freshwater | MYETTVRTPAGETKDRVFASNAQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0194133_101727264 | 3300021091 | Freshwater Lake | MPMYETTVRTPQGDQKDRVFARDLKEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0214164_10298716 | 3300021138 | Freshwater | AKRAVRIMPMYETEVRTPGGTQKDRVFAANAQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0194048_100660235 | 3300021519 | Anoxic Zone Freshwater | MPMYETTVHTPEGPKKERVYAPNAREAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0194048_100787424 | 3300021519 | Anoxic Zone Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS |
| Ga0213922_11021193 | 3300021956 | Freshwater | MPMYETKVKTPNGEQTERVFAPDAQEAKKLLEQRFGPRNVPFIPHMVPH |
| Ga0222718_100775584 | 3300021958 | Estuarine Water | MPLYETTVRTPNGEEKKQVYAENVQEARKLFEQLYGGPRRVPYIPHVIPS |
| Ga0222714_1000906115 | 3300021961 | Estuarine Water | MPMYEATVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0222714_100373857 | 3300021961 | Estuarine Water | MPMYETTVRTPNGEEKKRIFAETPQEAKKLFEQLYGGPRKVPYIPHVIPS |
| Ga0222714_101705555 | 3300021961 | Estuarine Water | MPLYETTVRTPQGEEKKRVFADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0222714_102645365 | 3300021961 | Estuarine Water | MPMYETTVRTPQGDTKDRVYAPTVQEAKKLFEQRHGPRNVPYIPHVIPS |
| Ga0222714_104990244 | 3300021961 | Estuarine Water | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPHVIPS |
| Ga0222713_101505004 | 3300021962 | Estuarine Water | MPMFEATVRTPTGDTKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH |
| Ga0222713_101675697 | 3300021962 | Estuarine Water | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0222713_101710983 | 3300021962 | Estuarine Water | MPMYETTVRTPQGEEKKRVYADTPQEARKLFEQMYGGPRAVPYIPKIVPS |
| Ga0222713_101770556 | 3300021962 | Estuarine Water | MPMYETTVRTPNGEEKKRVYADNVQEARKLFEQLYGGPRAVPYIPHVVPS |
| Ga0222713_101970702 | 3300021962 | Estuarine Water | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS |
| Ga0222713_102000151 | 3300021962 | Estuarine Water | ETTVRTPQGEEKKRVFADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0222713_103815862 | 3300021962 | Estuarine Water | MPMYETTVRTPQGEEKKRIFADTPQEAKKLFEQLYGGPRKVPYVPHVVPS |
| Ga0222713_105104252 | 3300021962 | Estuarine Water | MPMYETTVRTPQGEEKKKIYAATPQEAKKLFEQLYGGPRAVPYIPHVVPS |
| Ga0222713_107316821 | 3300021962 | Estuarine Water | MPLYEGTVRTAEGERKERVYADNPMEAKRLLEQLYGGPRAVPYIPHAI |
| Ga0222712_1000640811 | 3300021963 | Estuarine Water | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0222712_104446382 | 3300021963 | Estuarine Water | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHVIPS |
| Ga0222712_104831633 | 3300021963 | Estuarine Water | MPMYETTVRTSQGEEKKRIFADTPQEAKKLFEQLYGGPRAVPYIPRVVPS |
| Ga0181353_11454242 | 3300022179 | Freshwater Lake | MYETTVKTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHVVPS |
| Ga0181354_10504103 | 3300022190 | Freshwater Lake | MYEATVRTPQGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0181351_100088217 | 3300022407 | Freshwater Lake | MYETTVRTPQGEVKDRVYAETPQEAKQLFEQRHGPRNVPYIPKTIPS |
| Ga0181351_10037215 | 3300022407 | Freshwater Lake | MPMYETTVKTPEGEKKDKVYAQSAKEAKQLFEQRYGPRNVPYIPHVIAS |
| Ga0181351_10128294 | 3300022407 | Freshwater Lake | MYEATVRTPEGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0181351_12507712 | 3300022407 | Freshwater Lake | MPMYETTVRTPQGEEKKKIYADTPQEAKKLFEQLYGGPIAVPYIPHIIPS |
| Ga0212088_1002169316 | 3300022555 | Freshwater Lake Hypolimnion | MYETTVRTPNGETRDRVYAVNAQEAKKLFKQRHGPRNVPYIPHMIPS |
| Ga0212088_100541228 | 3300022555 | Freshwater Lake Hypolimnion | MYETTVRTPTGETKDRVYASNAQEAKRLFEQRHGPRNVPYIPHMIPS |
| Ga0236341_100069634 | 3300022591 | Freshwater | MPMYETEVHTPTGTQKDRVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0236341_10008954 | 3300022591 | Freshwater | MPMYETTVKTPNGDKKDRVFASTAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0236341_10351134 | 3300022591 | Freshwater | MPMYETTVKTPAGETQDRVFAANAQEAKRLFEQRHGPRNVPYIPHMIPS |
| Ga0236341_10614842 | 3300022591 | Freshwater | MPMYETTVKTPVGETKDRVFAPPAQEAKRLFEQRHGPRNVPYIPHMIPS |
| Ga0248169_1056499 | 3300022602 | Freshwater | MYETTVRTPEGEKKDRVWANSAHDAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0228702_10833271 | 3300022748 | Freshwater | MPMYETTVRTPQGERKDRVYAKDLAEARMLFEQRHGPRNVPYIPHVVPS |
| Ga0214917_1000000288 | 3300022752 | Freshwater | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQQYGGPRAVPYIPHIIPS |
| Ga0214917_102662702 | 3300022752 | Freshwater | MYETTVRTPEGDKKDRVYAKDLQEARTLFEQRYGPRNVPYIPHVIPS |
| Ga0214921_10000016413 | 3300023174 | Freshwater | MPMYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0214921_10000019186 | 3300023174 | Freshwater | MYETTVRTPEGERKDRVYAKDLQEARVLFEQRHGPRNVPYIPHIIPS |
| Ga0214921_100072749 | 3300023174 | Freshwater | MPMYETTVRTPEGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0214921_100269644 | 3300023174 | Freshwater | MGQQCKEIDMPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIIPS |
| Ga0214921_100401427 | 3300023174 | Freshwater | MPMYETTVKTPNGDTKERVYADNAQEAKKLLEQRFGPRNVPYIPHMIPH |
| Ga0214923_102198504 | 3300023179 | Freshwater | VKTPNGDTKERVYADNAQEAKKLLEQRFGPRNVPYIPHMIPH |
| Ga0256681_106727342 | 3300023311 | Freshwater | MPMYETTVKTSSGETKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0256681_124196308 | 3300023311 | Freshwater | MYETTVRTPTGETKDRVYAPNAQEAKRLFEQRHGPRNVPYIPHMIPS |
| Ga0255147_1000014174 | 3300024289 | Freshwater | MYETTVRTPQGETKDRVYAKDLQEARQLFEQRHGPRNVPYIPKVIPS |
| Ga0244775_100064263 | 3300024346 | Estuarine | MPMYEATIRTPVGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0244775_100140726 | 3300024346 | Estuarine | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPRAVPYIPNIIPS |
| Ga0244775_100192287 | 3300024346 | Estuarine | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0244775_100249481 | 3300024346 | Estuarine | VRTLQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS |
| Ga0244775_109146014 | 3300024346 | Estuarine | MPMYETTVRTPNGEEKKRVYADNVQEAKKLFEQLYGGPRKVPYIPHVVPS |
| Ga0244775_111856601 | 3300024346 | Estuarine | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHI |
| Ga0256338_11581562 | 3300024536 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIP |
| Ga0255280_11177251 | 3300024555 | Freshwater | PQGETKDRVYAKDLQEARQLFEQRHGPRNVPYIPKVIPS |
| Ga0255237_10594791 | 3300024564 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPY |
| Ga0255246_10906821 | 3300024863 | Freshwater | MPMYETTVRTPQGEIKDKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0209616_10094431 | 3300025091 | Freshwater | MPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIIPS |
| Ga0209616_10164273 | 3300025091 | Freshwater | MPMYETTVRTPSGEEKKRVYAATPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0208504_10149412 | 3300025358 | Freshwater | MPMYETTVRTPTGEIRDRVYAANAQEAKKLLEQRHGPRNVPFIPHMIPS |
| Ga0208504_10331022 | 3300025358 | Freshwater | MYETEVRTPVGTQKDRVFAASAQEAKRIFEQRHGPRNVPYIPHMIPS |
| Ga0208504_10407831 | 3300025358 | Freshwater | MPMYETTVRTPAGDVKDRVYALNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208620_10227553 | 3300025368 | Freshwater | MPMYETTVRTPAGDVKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208382_10289062 | 3300025369 | Freshwater | MPMYETEVRTPTGPQKDRVYAKDAQEAKMIFEQRHGPRNVPYIPHMIPS |
| Ga0208250_10391903 | 3300025383 | Freshwater | MQHKLTAKVVGNMPMYETEVRTPNGTQKDRVFAANAQEAKRLLEQRHGPRNVPYIPHMIP |
| Ga0208740_10092103 | 3300025391 | Freshwater | MPMYETEVRTPNGPVKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208380_100078918 | 3300025392 | Freshwater | MPMYETTVKTSNGEQKERVYAANAQEAKKLLEQRFGPRNVPYIPHMIPS |
| Ga0208380_10033721 | 3300025392 | Freshwater | MQHKLTAKVVGNMPMYETEVRTPNGTQKDRVFAANAQEAKRLLEQRHGPRNVPYI |
| Ga0208874_10466322 | 3300025396 | Freshwater | MYETTVRTPTGETKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208253_10211643 | 3300025418 | Freshwater | MPMYETTVRTPTGETKDRVYAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208746_10730652 | 3300025423 | Freshwater | MYETTVRTPTGETKDRVYASNAQEAKKLFEQRHGPRNVPYILHMIPS |
| Ga0208497_100037115 | 3300025466 | Freshwater | MYETEVRTPNGPVKDRVFAPNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208497_10868772 | 3300025466 | Freshwater | MYETTVRTPTGETKDRVYASNAQEAKKLFEQRHGPRNVPYIL |
| Ga0208260_10350632 | 3300025467 | Freshwater | MYETTVQTPNGETKDRVFAQNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0208741_100502311 | 3300025723 | Freshwater | PTKRAIRLMPMYETEVRTPNGTQKDRVYAQNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0255240_10223221 | 3300026568 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0255065_10920241 | 3300027142 | Freshwater | MYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHVVPS |
| Ga0209300_10283662 | 3300027365 | Deep Subsurface | MPMYETTVRTSNGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0255123_10363972 | 3300027589 | Freshwater | MYEATVRTPVGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0208974_10022228 | 3300027608 | Freshwater Lentic | MPMFEATVRTPNGDTKERVWADNVQEAKKLLEERFGPRNVPYLPHMIPH |
| Ga0208974_10252234 | 3300027608 | Freshwater Lentic | MPMYEATVRTPEGEKKDRVWAQDLAEARTLLEQRHGPRNVPYIPHIIPS |
| Ga0208133_10316101 | 3300027631 | Estuarine | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYG |
| Ga0208133_10669202 | 3300027631 | Estuarine | MPMYETTVRTPEGDKKDKVYAPTVQEAKKLFEQRHGPRNVPYVPHIIPS |
| Ga0209188_11086703 | 3300027708 | Freshwater Lake | MPMYETEVRTPNGPTKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0209599_10000001343 | 3300027710 | Deep Subsurface | MPMYEAVVRTPEGEKKQRVWAPDMKTARHLLEQEYGIKNVPYQPKIVPN |
| Ga0209599_1000007185 | 3300027710 | Deep Subsurface | MFWENYMPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0209599_1000226312 | 3300027710 | Deep Subsurface | MYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0209599_1001001612 | 3300027710 | Deep Subsurface | MPMYETTVKTPSGEQKERVYAPDAQEAKKLLEQRFGPRNVPYIPHMVPH |
| Ga0209599_100105768 | 3300027710 | Deep Subsurface | MPMYETTVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPRIIPS |
| Ga0209599_100738322 | 3300027710 | Deep Subsurface | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFESLYGGPRAVPYIPKIVAS |
| Ga0209599_101904681 | 3300027710 | Deep Subsurface | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHII |
| Ga0209617_102669963 | 3300027720 | Freshwater And Sediment | MPMYETTVRTPAGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0209617_103138141 | 3300027720 | Freshwater And Sediment | VLERENMMPVYETTVRTPQGEEKKRVYANDVKEAKQLFETLYGGPRAVPYVPKV |
| (restricted) Ga0247833_11923863 | 3300027730 | Freshwater | MYEATVRTPDGEKKDRVWARDLAEARMLLEQRHGPRNVPFIP |
| Ga0209087_10226506 | 3300027734 | Freshwater Lake | MPMYEATVRTPNGETKDRVFASTVQEAKQLLEQRHGPRNVPYIPHIIPS |
| Ga0209087_11416453 | 3300027734 | Freshwater Lake | MPMYETTVRTPEGERKDRVYAKDLHEARTLFEQRHGPRNVPYIPHIIPS |
| Ga0209087_12142411 | 3300027734 | Freshwater Lake | MPMYETTVRTPTGEIKDHVFAPTAQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0209084_13445672 | 3300027749 | Freshwater Lake | MYETTVRTPTGETKDRVFAPNIQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0209296_100000464 | 3300027759 | Freshwater Lake | MPMYETTVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209296_10010978 | 3300027759 | Freshwater Lake | MPMYETTVRTPEGERKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209296_10262617 | 3300027759 | Freshwater Lake | MPMYETTVRTPTGEIKDRVYAKDLQEARILFAQRHGPRNVPYIPHIIPS |
| Ga0209296_12272951 | 3300027759 | Freshwater Lake | MPMYETTVRTPEGERKDRVYAKDLHEARTLFEQRHGPRNVPYIPHI |
| Ga0209296_13567031 | 3300027759 | Freshwater Lake | MYETTVKTPKGDTKDRVYAKDAQEAKQLFEQRHGPRNVPYIPH |
| Ga0209296_14024241 | 3300027759 | Freshwater Lake | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQQYGGYVDQTDLD |
| Ga0209598_103090193 | 3300027760 | Freshwater Lake | RLIMPMYETTVRTPTGETKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209088_100267517 | 3300027763 | Freshwater Lake | MPMYETTVRTPTGEIKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209088_102394363 | 3300027763 | Freshwater Lake | MPLYEATVRTPQGEEKKQVWANNSQEARRLFEQMYGGPRAVPYLPRVIPS |
| Ga0209088_103934054 | 3300027763 | Freshwater Lake | EKRMPMYETTVRTPEGEKKEKVFAPNVQEAKKLFEQKYGPRNVPFIPHTIPS |
| Ga0209770_101806273 | 3300027769 | Freshwater Lake | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHTIPS |
| Ga0209500_1000037627 | 3300027782 | Freshwater Lake | MPMYETTVKTPTGETKDRVFAPNAQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0209500_100226107 | 3300027782 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0209500_102327511 | 3300027782 | Freshwater Lake | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVP |
| Ga0209500_102332483 | 3300027782 | Freshwater Lake | MPLYEATVRTPQGEEKKQIWADTPQEARRLFEQMYGGPRAVPYLPRVIPS |
| Ga0209972_1000561720 | 3300027793 | Freshwater Lake | MPMYETTVRTPQGDIKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0209972_103844032 | 3300027793 | Freshwater Lake | MPMYETTVRTPQGEIKDRVYANDPKEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0209353_100545454 | 3300027798 | Freshwater Lake | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPH |
| Ga0209353_101174812 | 3300027798 | Freshwater Lake | MPMYETTVRTPQGEQKDRVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0209358_101213744 | 3300027804 | Freshwater Lake | MPMYETTVKTTQGEVKDRVYAKDLQEAKQLFEQRHGPRNVPYIPKIIPS |
| Ga0209229_100815223 | 3300027805 | Freshwater And Sediment | MPMYETTVKTPQGEQKDRVYAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| Ga0209229_102502241 | 3300027805 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIYADNVQEARKLFEQLYGGPRAVPYIPKVVP |
| Ga0209990_1000626718 | 3300027816 | Freshwater Lake | MPLYETTVRTPQGEEKKRIYATTPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0209990_101910772 | 3300027816 | Freshwater Lake | MYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0209230_1000000547 | 3300027836 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIAS |
| Ga0209230_1000027829 | 3300027836 | Freshwater And Sediment | MPMYETTVRTPQGEEKKRIFADTPQEAKKLFETLYGGPRAVPYIPHIIPS |
| Ga0209230_100090762 | 3300027836 | Freshwater And Sediment | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0209550_100793463 | 3300027892 | Freshwater Lake | PEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209550_107844082 | 3300027892 | Freshwater Lake | MPMYETTVKTPKGEKKDQVYAQNAKEAKQLFEQRYGPRNVPYIPHVIAS |
| Ga0209777_104759543 | 3300027896 | Freshwater Lake Sediment | MPMFETVVHTPEGPKKERVYAENAREAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0209400_100281112 | 3300027963 | Freshwater Lake | MPMYETTVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYIPHIVPS |
| Ga0209191_10071671 | 3300027969 | Freshwater Lake | VRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHVIPS |
| (restricted) Ga0247837_10490283 | 3300027970 | Freshwater | MPMYEATVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| (restricted) Ga0247837_11924434 | 3300027970 | Freshwater | MPMYETTVKTPQGETKDRVYASTVQEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0209401_100282613 | 3300027971 | Freshwater Lake | MPMYETTVRTPTGETKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0209401_10064986 | 3300027971 | Freshwater Lake | MYETTVRTPTGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0247723_10250807 | 3300028025 | Deep Subsurface Sediment | MYETTVRTSNGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYI |
| Ga0247723_10306691 | 3300028025 | Deep Subsurface Sediment | YMPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0304729_10247924 | 3300028392 | Freshwater Lake | MPMYETTVKTSAGETKDRVFAPTAQEAKKLFEQRHGPRNVPYIPHMIPS |
| Ga0304730_13042621 | 3300028394 | Freshwater Lake | RTSAGETKDRVFAPNAQEAKKLLEQRHGPRNVPYIPHMIPS |
| (restricted) Ga0247832_10677745 | 3300028557 | Freshwater | MPMYEATVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIP |
| (restricted) Ga0247831_11870742 | 3300028559 | Freshwater | MYEATVRTPDGEKKDRVWARDLAEARMLLEQRHGPRNVPFIPHIIPS |
| Ga0239579_10067812 | 3300029442 | Freshwater Lake | MPMYETTVRTPNGETRDRVYAVNAQEAKKLFKQRHGPRNVPYIPHMIPS |
| Ga0307488_100377436 | 3300031519 | Sackhole Brine | MPMYEATVRTPNGEEKKRVYADTPQEAKKLLEQLHGGPRAVPYIPHIVAS |
| Ga0307376_103804151 | 3300031578 | Soil | MPMYEATIRTPQGEEKKKLFADNPQQAKKLFEQLYGG |
| Ga0315907_1000727215 | 3300031758 | Freshwater | MPMYEATVRTPEGEKKDRVYAKDLQEARQLLEQRHGPRNVPYVPHIIPS |
| Ga0315907_100381548 | 3300031758 | Freshwater | MPMYETTVRTPSGDVKDRVYAKDLQEARVLFEQRHGPRNVPYIPKVIPS |
| Ga0315907_1005765013 | 3300031758 | Freshwater | MPMYETTVRTPQGETKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKVIPS |
| Ga0315907_100717525 | 3300031758 | Freshwater | MPMYETTVRTPQGETKDRVYAKDLQEAKMLFEQRHGPRNVPYIPKIIPS |
| Ga0315907_100989133 | 3300031758 | Freshwater | MPMFEATVRTPNGDNKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH |
| Ga0315907_102319914 | 3300031758 | Freshwater | MPMYETTVRTPQGEEKKRIYADNVQEARKLFEQLYGGPRAVPYIPKVVPS |
| Ga0315907_102867683 | 3300031758 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEARKLFEQLYGGPRAVPYIPHIIPS |
| Ga0315907_103086704 | 3300031758 | Freshwater | MPMYEATVRTPSGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0315907_103840232 | 3300031758 | Freshwater | LCLGGAKETLSNKLLLNNFMPLYETTVRTPQGEEKKRIYATTPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0315907_103979514 | 3300031758 | Freshwater | ETTVRTPQGEQKDRVWARDLAEARQLLEQRHGPRNVPYIPKIIPS |
| Ga0315907_104121094 | 3300031758 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKVVPS |
| Ga0315907_106920423 | 3300031758 | Freshwater | MPMYETTVRTPEGEKKDRVYAKDLQEARVLFEQRHGPRNVPFIPHIVPS |
| Ga0315907_109746054 | 3300031758 | Freshwater | MPMYETTVKTAQGEVKDRVYAKDLQEAKQLFEQRHGPRNVPYIPKIIPS |
| Ga0315907_109892993 | 3300031758 | Freshwater | GRRFESCISDHYKEHIMPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0315907_112015834 | 3300031758 | Freshwater | MPMYETTVRTPQGDVKDRVYARDLKEARMLFEQRHGPRNVPYIPHVIPS |
| Ga0315899_1005925210 | 3300031784 | Freshwater | PMYETTVRTPQGDTKDRVYAPTVQEAKKLFEQRHGPRNVPYIPHVIPS |
| Ga0315899_101899109 | 3300031784 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFESLYGGPRAVPYIPKVVPS |
| Ga0315899_103783748 | 3300031784 | Freshwater | MPMYETTVRTPQGDTKDRVYAPTVQEAKKLFEQRHGPRNVPY |
| Ga0315899_115726075 | 3300031784 | Freshwater | MPMYEATVRTPEGDKKDKVYAPNVQEAKKLLEQRHGPRNVPYI |
| Ga0315900_105055285 | 3300031787 | Freshwater | MYETTVRTPQGEEKKRIYADTPQEAKKLFESLYGGPRAVPYIPKVVPS |
| Ga0315900_106263284 | 3300031787 | Freshwater | CMPMYETTVKTPQGEEKKRLYANDVKEAKKLFEQLYGGPRAVPYIPHTVPS |
| Ga0315900_107229194 | 3300031787 | Freshwater | YETTVRTPQGEEKKRIYADNVQEARKLFEQLYGGPRAVPYIPKVVPS |
| Ga0315909_1000026857 | 3300031857 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0315909_100518925 | 3300031857 | Freshwater | MPIFEATVRTSKGDTKERVWADNAQQAKKLLEERFGPRNVPYIPHMIPH |
| Ga0315909_1013001511 | 3300031857 | Freshwater | MPMYETTVRTPSGDIKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS |
| Ga0315909_101838386 | 3300031857 | Freshwater | MPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVPYIPHVIPS |
| Ga0315909_102264172 | 3300031857 | Freshwater | MPMFEATVRTPNGDTKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH |
| Ga0315909_102323214 | 3300031857 | Freshwater | MPMYETTVKTPNGDQKDRVYAPNLQEARKLFEQRHGPRNVPYIPHVVPS |
| Ga0315909_102355326 | 3300031857 | Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHMIPS |
| Ga0315909_102842213 | 3300031857 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQMYGGPRAVPYIPHIIPS |
| Ga0315909_105616192 | 3300031857 | Freshwater | MPMYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0315909_106010935 | 3300031857 | Freshwater | MPMYETTVRTPTGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIIPS |
| Ga0315909_106980721 | 3300031857 | Freshwater | MPMYETTVRTPQGDTKDRVYAKDLQEARMLFEQRHGPRNVPYIPHVVPS |
| Ga0315909_107416944 | 3300031857 | Freshwater | MYETTVRTPQGDTKDRVYAPTVQEAKKLFEQRHGPRNVPY |
| Ga0315909_109695961 | 3300031857 | Freshwater | MYEATVRTPQGEQKDRVWARDLAEARMLLEQRHGPRNVPY |
| Ga0315904_100776453 | 3300031951 | Freshwater | MPMYETTVRTPQGEVKDRVYAKDLQEARQLFEQRHGPRNVPYIPKVIPS |
| Ga0315904_102893996 | 3300031951 | Freshwater | MPMYEATVRTPEGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHVIPS |
| Ga0315904_103422816 | 3300031951 | Freshwater | MPMYETTVRTPQGEVKDRVYARDLTEARQLFEQRHGPRNVPYIPKIIPS |
| Ga0315904_104782984 | 3300031951 | Freshwater | MPMYEATIRTLQGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPHVVPS |
| Ga0315904_105138395 | 3300031951 | Freshwater | MYETTVKTPQGETKDRVWAKDLQEARQLFEQRHGPRNVPYIPKIIPS |
| Ga0315904_106393063 | 3300031951 | Freshwater | PEGEKKDRVYAKDLAEARVLFEQRHGPRNVPYIPHIIPS |
| Ga0315904_109983764 | 3300031951 | Freshwater | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0315904_112798173 | 3300031951 | Freshwater | IMPMYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0315901_100929081 | 3300031963 | Freshwater | MPIFEATVRTPNGDTKERVYADNAQQAKKLLEERFGPRNVPYIPHMIPH |
| Ga0315901_102513546 | 3300031963 | Freshwater | MPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVPYIPHVVPS |
| Ga0315901_103911363 | 3300031963 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKIIPS |
| Ga0315901_109569053 | 3300031963 | Freshwater | MPMYETTVKTPQGETKDRVWAKDLQEARQLFEQRHGPRNVPYIPKIIPS |
| Ga0315906_100271791 | 3300032050 | Freshwater | EIYMPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVPYIPHVIPS |
| Ga0315906_104809934 | 3300032050 | Freshwater | MPMYETTVRTPQGEEKKRIYADTPQEAKKLFETLYGGPR |
| Ga0315906_105611546 | 3300032050 | Freshwater | MPMYETTVRTPQGEIKDRVYAKDLQEARTLFEQRHGPRNVPYIPHV |
| Ga0315906_106784593 | 3300032050 | Freshwater | MIMPMYEATVRTPEGEKKDRVWAKDLAEARTLLEQRHGPRNVPYIPHIVPS |
| Ga0315902_104459062 | 3300032093 | Freshwater | MPMYETTVRTPQGENKDKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0315902_110514981 | 3300032093 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFEQLYGGPRAVP |
| Ga0315903_100429069 | 3300032116 | Freshwater | MLPVSGDPMPMYETTVRTPQGEQKDRVWARDLAEARQLLEQRHGPRNVPYIPKIIPS |
| Ga0315903_104884531 | 3300032116 | Freshwater | MYETTVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIVPS |
| Ga0315903_105046813 | 3300032116 | Freshwater | TVRTPGGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0315903_106759864 | 3300032116 | Freshwater | MKGNVMPMYEATVRTSQGETKDRVYAKDLTEAKQLFEQRHGPRNVPYVPKIIPS |
| Ga0315903_108923852 | 3300032116 | Freshwater | MPMYEATVRTPQGEEKKRIYADTLQEAKKLFEQLYGGPRAVPYIPHIVPS |
| Ga0316221_10883655 | 3300032665 | Freshwater | MYETTVRTPTGETKDRVYASNAQEAKRLLEQRHGPRNVPYIPHMIPS |
| Ga0334978_0181069_421_567 | 3300033979 | Freshwater | MYETTVRTPQGEEKKRVYADTPQEARKLFEQLYGGPRAVPYIPKIVPS |
| Ga0334978_0424807_417_560 | 3300033979 | Freshwater | MYETTVKTPQGETKDRVYASTVQEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0334981_0116697_2_136 | 3300033980 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLTEARMLFEQRHGPRNVPYIPK |
| Ga0334992_0183175_2_127 | 3300033992 | Freshwater | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVP |
| Ga0334992_0265970_374_523 | 3300033992 | Freshwater | MPMYETTVRTPQGETKDKVFAPNVQEAKKLFEQRHGPRNVPYLPHIIPS |
| Ga0334992_0446000_151_294 | 3300033992 | Freshwater | MYETTVRTPQGETKDRVYAKTVQEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0334996_0324144_88_231 | 3300033994 | Freshwater | MYETTVRTPEGDVKDRVYAKDLTEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0334996_0474524_428_565 | 3300033994 | Freshwater | MPMYEATVRTPTGEIKDRVFAKDLAEARLLFQQRHGPRNVPYIPHV |
| Ga0334996_0526042_269_418 | 3300033994 | Freshwater | MPMYETTVRTPEGDVKDRVYAKYLTEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0335003_0323055_101_247 | 3300033995 | Freshwater | MYETTVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYVPHIIPS |
| Ga0334979_0218530_791_934 | 3300033996 | Freshwater | MYETTVRTPQGETKDRVYAKTVQEAKVLFEQRHGPRNVPYIPKIIPS |
| Ga0334986_0120072_118_267 | 3300034012 | Freshwater | MPMYETTVRTPEGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0334991_0239870_536_679 | 3300034013 | Freshwater | MYEATVRTPEGEKKEKVFAPNVQEAKKLLEQRHGPRNVPYIPHIIPS |
| Ga0335002_0466916_2_118 | 3300034020 | Freshwater | MPMYETTVRTPQGDTKDKVFAPNVQEAKKLFEQKHGPRN |
| Ga0335002_0489229_371_517 | 3300034020 | Freshwater | MYETTVRTPQGEEKKRIYADTPQEAKRLFEQLYGGPRAVPYIPKIVAS |
| Ga0335005_0616764_3_107 | 3300034022 | Freshwater | MPMYEATVRTPSGEEKKRIYADTPQEAKKLFEQLY |
| Ga0335021_0217744_103_249 | 3300034023 | Freshwater | MYETTVRTPQGEEKKRIYAQDVKEAKKLFEQLYGGPRAVPYIPHMVPS |
| Ga0334987_0542651_553_699 | 3300034061 | Freshwater | MYETTVRTPSGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0334995_0000303_41923_42072 | 3300034062 | Freshwater | MPMYETTVKTPNGEKKDQVYAQNAKEAKQLFEQRYGPRNVPYIPHVIPS |
| Ga0334995_0749437_3_128 | 3300034062 | Freshwater | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYGPRNVPF |
| Ga0335000_0116003_1464_1616 | 3300034063 | Freshwater | MPLYETTVRTPEGEEKKRVYADTPQEAKKLFEQLYGGPRAVPYIPKIIPG |
| Ga0335019_0005309_1608_1754 | 3300034066 | Freshwater | MYEATVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHTVPS |
| Ga0335019_0014703_2_124 | 3300034066 | Freshwater | MYETTVRTPQGEEKKRVYADTPQEAKKLFETLYGGPRAVPY |
| Ga0335019_0049420_2272_2421 | 3300034066 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLAEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0335019_0159692_1209_1358 | 3300034066 | Freshwater | MPMYETTVRTPQGDTKDKVYAPNVQEAKKLFEQKHGPRNVPYIPHMIPS |
| Ga0334990_0046083_107_256 | 3300034068 | Freshwater | MPMYETTVRTPQGDTKDKVFAPNVQEAKKLFEQKHGPRNVPYIPHMIPS |
| Ga0335028_0130143_994_1143 | 3300034071 | Freshwater | MPMYETTVRTPQGEVKDRVYAKDLTEAKQLFEQRYGPRNVPYIPKVIPS |
| Ga0335028_0318472_542_691 | 3300034071 | Freshwater | MPMYETTVRTPEGDVKDRVYAKDLQEATMLFEQRHGPRNVPYIPKVIPS |
| Ga0335028_0552015_1_126 | 3300034071 | Freshwater | RTPKGDTKERVYADNAQEAKRLLEERFGPRNVPYIPHMIPH |
| Ga0335020_0000405_33426_33569 | 3300034082 | Freshwater | MYETTVRTPQGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0335020_0009682_1936_2082 | 3300034082 | Freshwater | MYETTVRTPQGEEKKRVYADNVQEAKKLLEQLYGGPRAVPYIPHVVPS |
| Ga0335020_0021205_3522_3665 | 3300034082 | Freshwater | MYETTVRTPAGEKKEKVFAPNVQEAKKLFEQTYGPRNVPFIPHIIPS |
| Ga0335020_0055194_1117_1266 | 3300034082 | Freshwater | MPMYETTVRTPQGDTKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHVIPS |
| Ga0335020_0162972_362_505 | 3300034082 | Freshwater | MYETTVRTPAGEKKEKVFAPNVQEAKKLFEQTYGPRNVPYIPHIIPS |
| Ga0335020_0171410_324_467 | 3300034082 | Freshwater | MYETTVRTPQGDTKDKVFAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0335020_0186844_532_675 | 3300034082 | Freshwater | MYETTVRTPQGETKDKVYAPNVQEAKKLFEQKHGPRNVPYIPHIIPS |
| Ga0335020_0414457_254_400 | 3300034082 | Freshwater | MYETTVRTPQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHIIAS |
| Ga0335020_0591766_248_424 | 3300034082 | Freshwater | VFLYGQEIIMPMYETTVRTPQGDAKDRVYAKDLQEARQLFEQRHGPRNVPYIPKVIPS |
| Ga0335020_0615268_309_506 | 3300034082 | Freshwater | HLELSHTCAKTKQRISMPMYEATVRTPEGEQKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0335010_0162424_2_157 | 3300034092 | Freshwater | ISMPMYEATVRTPQGEQKDRVWARDLAEARTLLEQRHGPRNVPYIPHIIPS |
| Ga0335012_0063314_1875_2024 | 3300034093 | Freshwater | MPMFEATVRTPKGDTKERVYADNAQEAKRLLEERFGPRNVPYIPHMIPH |
| Ga0335012_0068380_659_808 | 3300034093 | Freshwater | MPMYETTVRTPQGEKKEKVFAPNVQEAKKLFEQQYGPRNVPFIPHIIPS |
| Ga0335012_0246986_2_145 | 3300034093 | Freshwater | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHIV |
| Ga0335012_0491724_172_315 | 3300034093 | Freshwater | MYEATVRTPEGEKKDRVWAKDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0335022_0631942_378_521 | 3300034095 | Freshwater | MYETTVRTPQGETKDRVYASTVQEAKTLFEQRHGPRNVPYIPKIIPS |
| Ga0335029_0006286_4404_4553 | 3300034102 | Freshwater | MPMYETTVRTPQGEQKDRVWARDLAEARQLLEQRHGPRNVPYIPKIIPS |
| Ga0335029_0031528_3371_3523 | 3300034102 | Freshwater | MPMYETTVRTPQGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHIVAS |
| Ga0335029_0150091_644_787 | 3300034102 | Freshwater | MYEATVRTADGEKKDRVWARDLAEARMLLEQRHGPRNVPYIPHIIPS |
| Ga0335029_0240677_299_475 | 3300034102 | Freshwater | VFLYGLEITMPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYIPKVVPS |
| Ga0335030_0100579_1950_2099 | 3300034103 | Freshwater | MPMYETTVRTPQGDVKDRVYARDLQEARMLFEQRHGPRNVPYIPHVIPS |
| Ga0335030_0246460_940_1086 | 3300034103 | Freshwater | MYETTVKTPQGEEKKRLYANDVKEAKKLFEQLYGGPRAVPYIPHTVPS |
| Ga0335030_0816349_96_248 | 3300034103 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEARKLFEQLYGGPRAVPYIPKIVPS |
| Ga0335031_0003773_5171_5329 | 3300034104 | Freshwater | MQMPLYETTVRTPQGEEKKQVYADTPQEAKKLFEQLYGGPRAVPYLPKVIPS |
| Ga0335031_0027274_1494_1646 | 3300034104 | Freshwater | MPLYETTVKTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS |
| Ga0335031_0052811_183_335 | 3300034104 | Freshwater | MPLYETTVRTPQGEEKKRVYADTPQEAKKLFEQMYGGPRAVPYIPKVVPS |
| Ga0335031_0625352_333_485 | 3300034104 | Freshwater | MPMYETTVRTPQGEEKKRVYADTPQEAKKLFESLYGGPRAVPYIPKVVAS |
| Ga0335031_0740735_410_556 | 3300034104 | Freshwater | MYETTVRTPQGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYNPQIVPS |
| Ga0335035_0466333_3_125 | 3300034105 | Freshwater | MPMYETTVRTPQGETKDRVYAKTVQEAKALFEQRHGPRNVP |
| Ga0335036_0016281_2_145 | 3300034106 | Freshwater | YETTVRTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPHMIPS |
| Ga0335036_0291437_598_774 | 3300034106 | Freshwater | MFLYGLEIAMPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYVPKIIPS |
| Ga0335036_0508200_576_728 | 3300034106 | Freshwater | MPLYETTVRTPKGEEKKQIYAKDVQEAKKLFEQLYGGPRNVPYVPKVIPS |
| Ga0335036_0539453_571_717 | 3300034106 | Freshwater | MPMYETTVRTPQGETKDRVYARDLQEARMLFEQRHGPRNVPYIPKIIPS |
| Ga0335051_0083490_214_366 | 3300034109 | Freshwater | MPMYETTVRTPSGEEKKRIYAGTPQEAKKLFEQMYGGPRAVPYIPHIVPS |
| Ga0335063_0434394_2_196 | 3300034111 | Freshwater | LLRSPSVFLYVQEIAMPMYETTVRTPQGETKDRVYARDLQEARMLFEQRHGPRNVPYIPKIIPS |
| Ga0335063_0486488_349_498 | 3300034111 | Freshwater | MPMYETTVRTPEGEKKDRVYAKDLAEARVLFEQRHGPRNVPYIPHIIPS |
| Ga0335068_0081508_594_737 | 3300034116 | Freshwater | MYETTVRTPQGDVKDRVYAKDLTEARMLFEQRHGPRNVPYIPKVIPS |
| Ga0335068_0421707_437_580 | 3300034116 | Freshwater | MFEATVRTPKGDTKERVYADNAQEAKRLLEERFGPRNVPYIPHMIPH |
| Ga0335033_0581688_92_241 | 3300034117 | Freshwater | MPMYETTVRTPQGDTKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHIIPS |
| Ga0335053_0561838_526_663 | 3300034118 | Freshwater | MPMYETTVRTPEGDKKDKVYAPNVQEAKKLFEQRHGPRNVPYIPHV |
| Ga0335053_0758843_242_388 | 3300034118 | Freshwater | MYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPYIPHTVPS |
| Ga0335056_0687652_385_519 | 3300034120 | Freshwater | TVRTAEGERKERVYADNPMEAKRLLEQLYGGPRAVPYIPHAIPS |
| Ga0335060_0622648_14_166 | 3300034122 | Freshwater | MPMYETTVRTPNGEEKKRIYAATPQEAKKLFEQLYGGPRAVPYIPHTVPS |
| Ga0335065_0153923_611_760 | 3300034200 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLQEARMLFEQRHGPRNVPYVPKIIPS |
| Ga0335049_0406154_2_163 | 3300034272 | Freshwater | GEIIMPMYETTVRTPEGERKDRVYAKDLQEARTLFEQRHGPRNVPYIPHIVPS |
| Ga0335049_0776860_3_107 | 3300034272 | Freshwater | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLY |
| Ga0335049_0788896_437_562 | 3300034272 | Freshwater | MPMYETTVRTPQGDVKDRVYAKDLTEARMLFEQRHGPRNVPY |
| Ga0335052_0203645_1009_1137 | 3300034279 | Freshwater | MPMYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRAVPY |
| Ga0335052_0446927_20_166 | 3300034279 | Freshwater | MYETTVRTPSGEEKKRIYADTPQEAKKLFEQLYGGPRSVPYIPKVVPS |
| Ga0335052_0632755_3_122 | 3300034279 | Freshwater | MPMYETTVRTPQGETKDKVFAPNVQEAKKLFEQRHGPRNV |
| Ga0335007_0782123_394_519 | 3300034283 | Freshwater | MPMYETTVRTPQGETKDRVYASTVQEAKSLFEQRHGPRNVPY |
| Ga0335013_0108050_1336_1479 | 3300034284 | Freshwater | MYETTVRTPQGETKDRVYAKTLQEAKALFEQRHGPRNVPYIPKIIPS |
| Ga0335013_0222107_627_779 | 3300034284 | Freshwater | MPMYETTVRTSGGEEKKRIFADTPQEAKKLFEQLYGGPRAVPYIPKIVPS |
| Ga0335048_0270529_787_894 | 3300034356 | Freshwater | MPMYEATVRTPQGEEKKRIYADTPQEAKKLFEQLYG |
| Ga0335048_0330448_435_584 | 3300034356 | Freshwater | MPMYETTVRTPQGEKKEKIFAPNVQEAKKLFEQTYGPRNVPFIPHIIPN |
| ⦗Top⦘ |