


| Basic Information | |
|---|---|
| Taxon OID | 3300017655 Open in IMG/M |
| Scaffold ID | Ga0182739_1016431 Open in IMG/M |
| Source Dataset Name | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4521 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037930 | Metagenome / Metatranscriptome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182739_10164313 | F037930 | GAG | MFGGMSVSITKGGKPKRSIASIRVERRYRNVIRLFLSGELPEFTHQRHVHVANILKHIPYGRELMHLGLQVMAYRNFVPDKYNVEITDRHWSQLDGTLPAVELFDDLPGGACGEREVGV |
| ⦗Top⦘ |