NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017655

3300017655: Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2)



Overview

Basic Information
IMG/M Taxon OID3300017655 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191743 | Ga0182739
Sample NameEnriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size774665585
Sequencing Scaffolds15
Novel Protein Genes16
Associated Families16

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available2
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003289Metagenome / Metatranscriptome495Y
F004649Metagenome / Metatranscriptome429Y
F005470Metagenome / Metatranscriptome399Y
F008211Metagenome / Metatranscriptome337Y
F015908Metagenome / Metatranscriptome251Y
F020088Metagenome / Metatranscriptome226Y
F025080Metagenome203Y
F028375Metagenome / Metatranscriptome191Y
F030705Metagenome / Metatranscriptome184Y
F036409Metagenome / Metatranscriptome170N
F037930Metagenome / Metatranscriptome167Y
F047414Metagenome / Metatranscriptome149Y
F057501Metagenome / Metatranscriptome136Y
F073619Metagenome / Metatranscriptome120Y
F087411Metagenome / Metatranscriptome110Y
F092682Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0182739_1009146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea7012Open in IMG/M
Ga0182739_1016431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4521Open in IMG/M
Ga0182739_1016844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea4429Open in IMG/M
Ga0182739_1022925All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus3506Open in IMG/M
Ga0182739_1030366All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2852Open in IMG/M
Ga0182739_1064467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1681Open in IMG/M
Ga0182739_1078129All Organisms → cellular organisms → Bacteria → Proteobacteria1478Open in IMG/M
Ga0182739_1133536Not Available1033Open in IMG/M
Ga0182739_1181163Not Available845Open in IMG/M
Ga0182739_1200285All Organisms → cellular organisms → Eukaryota790Open in IMG/M
Ga0182739_1206348All Organisms → cellular organisms → Bacteria775Open in IMG/M
Ga0182739_1207392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium773Open in IMG/M
Ga0182739_1253806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium677Open in IMG/M
Ga0182739_1293298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium616Open in IMG/M
Ga0182739_1352942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0182739_1009146Ga0182739_10091469F003289MXGNIVTEVALQTNFGVGFNNTKSDVLIHLTQXQYXWXFWFSFLWAFYYLVILRIVRFRTLKFRPRLATTFRPHGKXGDLIICLIPVSXCANIITNSTLILRMIEXQAETGLLTVRIRGKQXYXIYKFELKTFTDVLTVPKNIGNNKWWISTPGDLQVSDDYLHILQLRSQNKXV
Ga0182739_1016431Ga0182739_10164313F037930MFGGMSVSITKGGKPKRSIASIRVERRYRNVIRLFLSGELPEFTHQRHVHVANILKHIPYGRELMHLGLQVMAYRNFVPDKYNVEITDRHWSQLDGTLPAVELFDDLPGGACGEREVGV
Ga0182739_1016844Ga0182739_10168445F047414MHRDSLILSPLFSSNNHNGGFFGNFTPRYFSNVPHMPDNNKGFGPDDFLMRPSPTHMDIDVNSRFDKAVDNLKMELRNNPAPLMNDHHGMDQQGLNLDIDLIDDSYLHAPLTKSPHIQFPGSQPTSKCSFKKFGEWTLSPNASFLPRKKF
Ga0182739_1022925Ga0182739_10229253F020088MESQNDKKKGRFRIEKLEERIAPSITLENPAGNTPQSESANNGQAIEAVNPAGHAPPGQN
Ga0182739_1022925Ga0182739_10229254F004649MQFRNNERKVRFRIEKLEERIAPSNANFPPGQFPSGNPAQAPGQSNPNEVPATNPSND
Ga0182739_1030366Ga0182739_10303664F057501AATVAAAKAAGAKMEGDVATVPIGGTPIKIAMLVDPDGNALEIMELPKDLTHLPH
Ga0182739_1064467Ga0182739_10644671F025080MISFATDFRALWIALMTMLAGATSVAAQSAPIGCPPPRTIYTFTDSSSIQALPGAPAPFCRFANVNGGQQVDLFLGAFSAASPIVQANIDVLTTLLPLQVGKAVHLVRAGTGDKGWQANVSVEKHESVEVPVGRLNCFVLLWTEPSGQGRWERRWWYCPSLEYAAKYSAKFEVVSPGGRILSSSPTRWKLAGIRVP
Ga0182739_1078129Ga0182739_10781294F015908MRYVTIAEVLGMLATQAQAESRTYRTQLIPKKSVQACSGWGQTYTVDVSNGVLTLGVNYARRLFSEPAESDGKITRSYRNPSGGILKFIGHGDGEYE
Ga0182739_1133536Ga0182739_11335361F028375MDTSVACEQWLSSYPKFNWRSTFNFLQAPEVIKAVEFCDNGIACFVKGLQHELQDKDYQEAFNCYENGAMQLDSLCLFRLHEIYLGDTNFNVEYNERQAMCHLIYSALVSQFETFDHKVTFWGKLESFWKKDAANKDYILDLLMNPPTDYFQATGPLFAKLFTFYNNKETFIDILPELKSLSIDVTKNKFFSILNAIFDFMAYSYNSSFSKTDLEKYVETILDMLTNDILFDNFFQSYVAHLRIIRAKKKFAF
Ga0182739_1181163Ga0182739_11811631F092682MHRTRHYLAALSARQSAAWRVCACIIDRSFVVIRLKHPAA
Ga0182739_1200285Ga0182739_12002851F005470MSIKLRKEGQLITEFPNDMVPRSRLLTKLVEEFNSTEVDLEPAPGKDFSPATINKVKEFLQKFDKGLNKMPKKPLLIFVTYNDWLDNNFDEKLREWLEEFLKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTQYQDFFTPEEEAKFIEKEFINKNDFEGVAAEDEEELNKE
Ga0182739_1206348Ga0182739_12063481F036409GKFHTLLFVHYDPETKKWKGPVVEAPFNDWNIDGGCPNFDAAGNIMIWSAGYDRGPDVITGGESGAGGVYDLYWLPTSEVIDYYKKAAGIG
Ga0182739_1207392Ga0182739_12073923F008211MIILDGESSILRARGEPIIFRSQEETMEYAKLHDIQRWMIYGDRDGWWPIYTQDGPISAPPPPKERVDISLH
Ga0182739_1253806Ga0182739_12538061F087411KTYVSQEATKLCADLFALGGGRHYRRNDIAARLLADSFAGTALRPPLALGLDGLLAQFED
Ga0182739_1293298Ga0182739_12932982F030705QHRRRPRPPEVEAERLRLVRRLQLIQRMQAEGTSDDDFSTRLKSFVDAPREARLVDGDNPFLEALLKTWDAAQLPQAATLAAGAQPPAPSATVEFRW
Ga0182739_1352942Ga0182739_13529421F073619RLELAPSVRATLTAWMRLYGDANALPGLATGPIETRFARLREHGGADTLDLWSTPARWAAGEGLSLRMPAIRLEFVCELDDGHLTATKVAQVPEDARLPDRETGAVGVHLVVERMELPPDRIEGEATDPGVKLLEGHFARLADRRWGGFVEPLRQALEAEASDDEDRTQRLTVRFTGASM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.