


| Basic Information | |
|---|---|
| Taxon OID | 3300014706 Open in IMG/M |
| Scaffold ID | Ga0135354_142741 Open in IMG/M |
| Source Dataset Name | Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0995 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | HiThru Analytics LLC |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 502 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington, D.C | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078693 | Metagenome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135354_1427411 | F078693 | N/A | LVKWLCAPRGPERSFIKADYSLLMSKENQKTTSDFDALDPRERGCSPLSDPEGVVETEKS |
| ⦗Top⦘ |