


| Basic Information | |
|---|---|
| Taxon OID | 3300014288 Open in IMG/M |
| Scaffold ID | Ga0121464_107858 Open in IMG/M |
| Source Dataset Name | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Weill Cornell Medical College |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 574 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA:New York City | |||||||
| Coordinates | Lat. (o) | 40.63 | Long. (o) | -73.99 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002471 | Metagenome / Metatranscriptome | 556 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0121464_1078581 | F002471 | N/A | CSEHLVSISKLNDEVASLNAQLKTSKSEVDKIKFARDAYTVGRHPSIKDGLGFKREAKNLTSHKAPIFVKEKGKAPMASNAKKNHAFMYYDRRNARNAYNDFDSHVYDSHAMFASSSSYKHDRDMPRRNIAHVPRKNVIHAPRKVVNEPSIIYCALNTSFAICRKDRKIVARKLGAKCKGDRTCIWVPKD |
| ⦗Top⦘ |