NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0150985_101038661

Scaffold Ga0150985_101038661


Overview

Basic Information
Taxon OID3300012212 Open in IMG/M
Scaffold IDGa0150985_101038661 Open in IMG/M
Source Dataset NameCombined assembly of Hopland grassland soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1092
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location
Location NameHopland, California, USA
CoordinatesLat. (o)38.972988Long. (o)-123.116539Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055245Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0150985_1010386612F055245N/AMQMTVEEYREGFRNHTLAFCMPAAHAEFSSHFLDEFSERILRKDWRDVSMTNCSRTPSLLNDEESEEEIVAEIHEVYGVDVSDLPGLPLWEVLRRCAQSSG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.