


| Basic Information | |
|---|---|
| Taxon OID | 3300012002 Open in IMG/M |
| Scaffold ID | Ga0153774_1007324 Open in IMG/M |
| Source Dataset Name | Saline lake microbial mat microbial communities from Tebenquiche Lake, II Region de Antofagasta, Chile - Tebenquiche 201212 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | INDEAR Instituto de Agrobiotecnologia Rosario |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10935 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Saline Lake Microbial Mat → Saline Lake Microbial Mat Microbial Communities From Tebenquiche Lake, Ii Region De Antofagasta, Chile |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | II Region de Antofagasta, Chile | |||||||
| Coordinates | Lat. (o) | -23.138472 | Long. (o) | -68.247194 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089904 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153774_10073248 | F089904 | N/A | MSEEVPEEIKKKIFKMISTPGTDIEEIANEVNLEFDQVMEILSEEYLRSNLDYGRRLCCRF* |
| ⦗Top⦘ |