


| Basic Information | |
|---|---|
| Taxon OID | 3300009855 Open in IMG/M |
| Scaffold ID | Ga0131806_1024758 Open in IMG/M |
| Source Dataset Name | Hot spring soil microbial communities from Dewar Creek, Kimberly, BC, Canada ? 2012, Sample 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Calgary |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1056 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Soil → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kimberly, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 49.9543667 | Long. (o) | -116.5155 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035241 | Metagenome | 172 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131806_10247581 | F035241 | N/A | NTSRPPSFNPRPWISFMARVLQGPEQAQRAYRELLGLEGSSRERAVDFMAQMARGYGLDLTPWFEAILRFHPAPTARAAAAAYLAAEGREDTVLEVLESLRPPLLTMTLLTGLLDALAPRPATPERVARLTAFAQRFNDDEHYTTLYLGDFTGRDVKRLVRRAVAESLLRQHAPEAVSWPRG* |
| ⦗Top⦘ |